Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g1731.t1
Gene name
Locationscaffold_02:700403..701206
Strand+
Gene length (bp)803
Transcript length (bp)753
Coding sequence length (bp)753
Protein length (aa) 251

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00657 Lipase_GDSL GDSL-like Lipase/Acylhydrolase 5.8E-12 19 225
PF13472 Lipase_GDSL_2 GDSL-like Lipase/Acylhydrolase family 3.3E-11 23 218

GO

GO Term Description Terminal node
GO:0016788 hydrolase activity, acting on ester bonds Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0016787 hydrolase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 26.57 11.81 41.34
5d_25C Five days - 25 degrees Celsius 26.08 11.56 40.60
7d_25C Seven days - 25 degrees Celsius 19.20 7.62 30.78
10d_25C Ten days - 25 degrees Celsius 20.79 8.69 32.90
7d_15C Seven days - 15 degrees Celsius 27.52 12.42 42.62
7d_30C Seven days - 30 degrees Celsius 33.24 15.85 50.63

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.969854 no
3d_25C 7d_25C 0.372593 no
3d_25C 7d_15C 0.942250 no
3d_25C 7d_30C 0.535998 no
3d_25C 10d_25C 0.507695 no
5d_25C 7d_25C 0.407970 no
5d_25C 7d_15C 0.910217 no
5d_25C 7d_30C 0.501951 no
5d_25C 10d_25C 0.554031 no
7d_25C 7d_15C 0.318540 no
7d_25C 7d_30C 0.081384 no
7d_25C 10d_25C 0.874698 no
7d_15C 7d_30C 0.620675 no
7d_15C 10d_25C 0.436871 no
7d_30C 10d_25C 0.134199 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g1731.t1
MKSAILLSAVIPSALGATIYLAGDSTMAKGGTGSGTAGWGEYVTPYTSLTVSNQAVAGRSARSYTREGRFDAIAA
VVQSGDWVIIEFGHNDGGSLTPTDNGRTDCSGTGSETCSTTYDGVAETVLTFPAYVENATKVFKAKGANVIISSQ
TPNNPWETGTFTYAPSRFVGYAQVAAAAAGVPYVDHGAYVADQFQTLGLTAVDAYFPLDHTHTSPTGASVVAQAF
FKAVVCGDVALKSSLTTTSFPGSCL*
Coding >Pro_DTO377G3_2|g1731.t1
ATGAAATCTGCTATTCTTCTCTCCGCGGTCATCCCCAGTGCGCTAGGTGCGACCATCTACCTCGCTGGTGACTCA
ACTATGGCAAAGGGTGGGACTGGATCTGGCACAGCGGGTTGGGGTGAATATGTTACGCCCTATACCTCACTCACC
GTGTCCAATCAAGCTGTCGCCGGCCGCAGCGCACGGTCATACACGCGTGAAGGTCGGTTCGATGCAATTGCAGCA
GTGGTTCAATCAGGAGATTGGGTGATCATCGAGTTCGGCCACAACGACGGTGGCTCTTTGACTCCCACCGACAAC
GGGCGCACCGATTGTTCTGGCACAGGAAGCGAGACTTGTAGCACAACCTACGACGGGGTCGCCGAGACAGTGTTG
ACGTTCCCGGCATATGTCGAGAATGCCACCAAGGTGTTCAAGGCCAAGGGTGCGAATGTGATCATCTCGAGCCAA
ACACCCAACAACCCCTGGGAAACTGGAACCTTCACCTATGCCCCCTCGCGGTTTGTGGGCTATGCGCAGGTGGCA
GCTGCAGCCGCCGGAGTGCCCTATGTTGACCACGGGGCCTATGTGGCCGACCAGTTCCAGACGCTGGGCCTGACT
GCTGTCGATGCCTACTTCCCCTTGGACCACACGCACACCAGTCCTACCGGTGCATCGGTAGTGGCCCAGGCCTTT
TTCAAGGCTGTGGTTTGTGGTGATGTTGCGCTGAAGAGTTCCCTGACCACCACATCTTTCCCTGGTTCGTGTCTC
TAA
Transcript >Pro_DTO377G3_2|g1731.t1
ATGAAATCTGCTATTCTTCTCTCCGCGGTCATCCCCAGTGCGCTAGGTGCGACCATCTACCTCGCTGGTGACTCA
ACTATGGCAAAGGGTGGGACTGGATCTGGCACAGCGGGTTGGGGTGAATATGTTACGCCCTATACCTCACTCACC
GTGTCCAATCAAGCTGTCGCCGGCCGCAGCGCACGGTCATACACGCGTGAAGGTCGGTTCGATGCAATTGCAGCA
GTGGTTCAATCAGGAGATTGGGTGATCATCGAGTTCGGCCACAACGACGGTGGCTCTTTGACTCCCACCGACAAC
GGGCGCACCGATTGTTCTGGCACAGGAAGCGAGACTTGTAGCACAACCTACGACGGGGTCGCCGAGACAGTGTTG
ACGTTCCCGGCATATGTCGAGAATGCCACCAAGGTGTTCAAGGCCAAGGGTGCGAATGTGATCATCTCGAGCCAA
ACACCCAACAACCCCTGGGAAACTGGAACCTTCACCTATGCCCCCTCGCGGTTTGTGGGCTATGCGCAGGTGGCA
GCTGCAGCCGCCGGAGTGCCCTATGTTGACCACGGGGCCTATGTGGCCGACCAGTTCCAGACGCTGGGCCTGACT
GCTGTCGATGCCTACTTCCCCTTGGACCACACGCACACCAGTCCTACCGGTGCATCGGTAGTGGCCCAGGCCTTT
TTCAAGGCTGTGGTTTGTGGTGATGTTGCGCTGAAGAGTTCCCTGACCACCACATCTTTCCCTGGTTCGTGTCTC
TAA
Gene >Pro_DTO377G3_2|g1731.t1
ATGAAATCTGCTATTCTTCTCTCCGCGGTCATCCCCAGTGCGCTAGGTGCGACCATCTACCTCGCTGGTGACTCA
ACTATGGCAAAGGGTGGGACTGGATCTGGCACAGCGGGTACGTGTTTTCCTTGAAGCTTCCGGATAGCATCATGC
TAATACTCCCAGGTTGGGGTGAATATGTTACGCCCTATACCTCACTCACCGTGTCCAATCAAGCTGTCGCCGGCC
GCAGCGCACGGTCATACACGCGTGAAGGTCGGTTCGATGCAATTGCAGCAGTGGTTCAATCAGGAGATTGGGTGA
TCATCGAGTTCGGCCACAACGACGGTGGCTCTTTGACTCCCACCGACAACGGGCGCACCGATTGTTCTGGCACAG
GAAGCGAGACTTGTAGCACAACCTACGACGGGGTCGCCGAGACAGTGTTGACGTTCCCGGCATATGTCGAGAATG
CCACCAAGGTGTTCAAGGCCAAGGGTGCGAATGTGATCATCTCGAGCCAAACACCCAACAACCCCTGGGAAACTG
GAACCTTCACCTATGCCCCCTCGCGGTTTGTGGGCTATGCGCAGGTGGCAGCTGCAGCCGCCGGAGTGCCCTATG
TTGACCACGGGGCCTATGTGGCCGACCAGTTCCAGACGCTGGGCCTGACTGCTGTCGATGCCTACTTCCCCTTGG
ACCACACGCACACCAGTCCTACCGGTGCATCGGTAGTGGCCCAGGCCTTTTTCAAGGCTGTGGTTTGTGGTGATG
TTGCGCTGAAGAGTTCCCTGACCACCACATCTTTCCCTGGTTCGTGTCTCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail