Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g1711.t1
Gene name
Locationscaffold_02:660539..662220
Strand-
Gene length (bp)1681
Transcript length (bp)1551
Coding sequence length (bp)1551
Protein length (aa) 517

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05057 DUF676 Putative serine esterase (DUF676) 1.6E-04 71 199

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 57 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 1.37 0.16 2.59
5d_25C Five days - 25 degrees Celsius 1.41 0.18 2.65
7d_25C Seven days - 25 degrees Celsius 1.29 0.05 2.54
10d_25C Ten days - 25 degrees Celsius 0.47 0.00 1.07
7d_15C Seven days - 15 degrees Celsius 0.83 0.00 1.70
7d_30C Seven days - 30 degrees Celsius 2.52 0.44 4.60

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.969800 no
3d_25C 7d_25C 0.940316 no
3d_25C 7d_15C 0.410607 no
3d_25C 7d_30C 0.228085 no
3d_25C 10d_25C 0.118302 no
5d_25C 7d_25C 0.911510 no
5d_25C 7d_15C 0.387375 no
5d_25C 7d_30C 0.264261 no
5d_25C 10d_25C 0.107013 no
7d_25C 7d_15C 0.503574 no
7d_25C 7d_30C 0.202164 no
7d_25C 10d_25C 0.146643 no
7d_15C 7d_30C 0.044390 yes
7d_15C 10d_25C 0.484346 no
7d_30C 10d_25C 0.021163 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g1711.t1
MFFRKQRHAKPELYPDSPSSSRDSTKSSRSLFSLSKALPRTSNTSDGQAESVKGPLGLSLLYSPTAPEIDFIFVH
GLGGNSRKTWTKSSLRYNFWPREWLSKDPAFKNVRIHSYGYDSYYLKGKEDCLNIHHISKSFLGAISTSPCILNS
GTHIVVIGHSKGGLVIKKAYILAKQDEVYKALAGRFAAFYFLATPHRGADSAKILKNLLKVAYDRAYVGDLEPNS
GAVQNMKMFSSLIVDPESAVLGYREEQQIPMTADHRSICKFDTPADPNYAVLRNALASTVNKITAAIPELKLKQR
RERIKNLKKYLKVPDILDNDLTNVCEARMHGTCGWISTKASHVKWRDGESGNDRTLWIKGNPATGKSVLAGYVID
QLKDSGQTCSYFFFKHGDKSKSNLGCCLRSLAFQMASSNSEASDAILGIQADGVCLDRVDEHTLWRILFLSGIFQ
ATMTRHFWVIDALDECFNPPVLLYAIISNMDESIPLRILITSRIRSIWTKVSRLLHPTWSSPCQSR*
Coding >Pro_DTO377G3_2|g1711.t1
ATGTTCTTTCGAAAGCAGCGGCACGCAAAGCCCGAACTATATCCCGACAGTCCCTCAAGTAGTCGCGACTCGACT
AAGAGCTCGAGGAGCCTGTTTTCTCTGTCAAAGGCCCTGCCCAGGACGTCAAACACATCGGACGGTCAAGCGGAG
AGCGTAAAAGGCCCTCTTGGACTGAGTCTCCTATATTCCCCGACGGCACCGGAGATCGACTTCATCTTCGTCCAT
GGCCTAGGCGGTAATTCTAGAAAAACATGGACCAAATCGTCTCTGCGGTATAATTTCTGGCCAAGGGAGTGGCTC
TCCAAAGATCCCGCATTCAAGAACGTCCGCATTCATAGCTATGGATACGATTCGTACTACTTGAAAGGAAAAGAG
GACTGCTTGAATATACACCACATTAGCAAGTCATTCCTAGGTGCGATCAGCACTTCGCCATGCATTCTCAATTCT
GGAACACACATCGTTGTCATCGGCCACAGCAAGGGTGGCTTAGTGATAAAGAAAGCATATATCCTGGCTAAACAA
GACGAAGTGTACAAGGCGCTGGCTGGGCGATTCGCCGCATTCTATTTTCTCGCCACGCCGCATCGAGGTGCCGAT
TCGGCAAAGATTCTGAAGAACCTCCTCAAGGTTGCATACGACCGTGCTTATGTTGGCGATCTGGAACCAAATTCT
GGGGCAGTCCAAAATATGAAAATGTTTAGCTCACTCATCGTCGATCCCGAGTCGGCCGTCCTCGGGTACCGTGAA
GAGCAGCAGATACCCATGACTGCTGACCACCGCTCGATATGCAAGTTTGACACACCTGCAGACCCCAACTATGCC
GTCCTCCGAAACGCGCTCGCCTCTACTGTGAACAAAATCACCGCGGCAATTCCGGAGCTGAAACTGAAGCAGAGG
CGTGAGAGAATCAAAAATCTCAAGAAGTACCTGAAAGTTCCCGACATCTTAGACAATGATCTTACAAACGTCTGC
GAAGCTCGGATGCATGGGACCTGCGGATGGATTTCGACCAAAGCCAGTCACGTCAAATGGAGAGATGGGGAATCC
GGAAATGACAGGACACTATGGATAAAGGGCAATCCAGCAACTGGAAAATCTGTTCTCGCTGGCTATGTCATCGAT
CAGCTCAAGGACTCTGGCCAGACATGCAGCTACTTTTTCTTCAAACATGGAGACAAGTCGAAGTCCAACCTAGGT
TGTTGTCTCCGATCTCTGGCTTTTCAGATGGCTAGCTCTAATAGCGAAGCTAGTGATGCGATTCTAGGAATACAG
GCGGATGGTGTTTGCTTAGATCGTGTCGACGAACATACCCTCTGGAGAATCCTCTTCCTTTCTGGCATTTTCCAG
GCCACAATGACTCGGCATTTCTGGGTCATCGACGCCCTAGACGAGTGTTTCAATCCTCCGGTCCTTTTATATGCC
ATTATTTCCAACATGGACGAATCTATACCCCTGAGAATTCTCATCACAAGTCGTATACGGTCGATCTGGACCAAG
GTCTCTCGTTTATTGCACCCGACCTGGTCCAGTCCTTGCCAATCTCGATAA
Transcript >Pro_DTO377G3_2|g1711.t1
ATGTTCTTTCGAAAGCAGCGGCACGCAAAGCCCGAACTATATCCCGACAGTCCCTCAAGTAGTCGCGACTCGACT
AAGAGCTCGAGGAGCCTGTTTTCTCTGTCAAAGGCCCTGCCCAGGACGTCAAACACATCGGACGGTCAAGCGGAG
AGCGTAAAAGGCCCTCTTGGACTGAGTCTCCTATATTCCCCGACGGCACCGGAGATCGACTTCATCTTCGTCCAT
GGCCTAGGCGGTAATTCTAGAAAAACATGGACCAAATCGTCTCTGCGGTATAATTTCTGGCCAAGGGAGTGGCTC
TCCAAAGATCCCGCATTCAAGAACGTCCGCATTCATAGCTATGGATACGATTCGTACTACTTGAAAGGAAAAGAG
GACTGCTTGAATATACACCACATTAGCAAGTCATTCCTAGGTGCGATCAGCACTTCGCCATGCATTCTCAATTCT
GGAACACACATCGTTGTCATCGGCCACAGCAAGGGTGGCTTAGTGATAAAGAAAGCATATATCCTGGCTAAACAA
GACGAAGTGTACAAGGCGCTGGCTGGGCGATTCGCCGCATTCTATTTTCTCGCCACGCCGCATCGAGGTGCCGAT
TCGGCAAAGATTCTGAAGAACCTCCTCAAGGTTGCATACGACCGTGCTTATGTTGGCGATCTGGAACCAAATTCT
GGGGCAGTCCAAAATATGAAAATGTTTAGCTCACTCATCGTCGATCCCGAGTCGGCCGTCCTCGGGTACCGTGAA
GAGCAGCAGATACCCATGACTGCTGACCACCGCTCGATATGCAAGTTTGACACACCTGCAGACCCCAACTATGCC
GTCCTCCGAAACGCGCTCGCCTCTACTGTGAACAAAATCACCGCGGCAATTCCGGAGCTGAAACTGAAGCAGAGG
CGTGAGAGAATCAAAAATCTCAAGAAGTACCTGAAAGTTCCCGACATCTTAGACAATGATCTTACAAACGTCTGC
GAAGCTCGGATGCATGGGACCTGCGGATGGATTTCGACCAAAGCCAGTCACGTCAAATGGAGAGATGGGGAATCC
GGAAATGACAGGACACTATGGATAAAGGGCAATCCAGCAACTGGAAAATCTGTTCTCGCTGGCTATGTCATCGAT
CAGCTCAAGGACTCTGGCCAGACATGCAGCTACTTTTTCTTCAAACATGGAGACAAGTCGAAGTCCAACCTAGGT
TGTTGTCTCCGATCTCTGGCTTTTCAGATGGCTAGCTCTAATAGCGAAGCTAGTGATGCGATTCTAGGAATACAG
GCGGATGGTGTTTGCTTAGATCGTGTCGACGAACATACCCTCTGGAGAATCCTCTTCCTTTCTGGCATTTTCCAG
GCCACAATGACTCGGCATTTCTGGGTCATCGACGCCCTAGACGAGTGTTTCAATCCTCCGGTCCTTTTATATGCC
ATTATTTCCAACATGGACGAATCTATACCCCTGAGAATTCTCATCACAAGTCGTATACGGTCGATCTGGACCAAG
GTCTCTCGTTTATTGCACCCGACCTGGTCCAGTCCTTGCCAATCTCGATAA
Gene >Pro_DTO377G3_2|g1711.t1
ATGGTTGACTCTCACCTCCTTGGCCTCCTGGGAAACTTCCCTCTTACCAGATCGCTGACTGTACCAGTTCTTTCG
AAAGCAGCGGCACGCAAAGCCCGAACTATATCCCGACAGTCCCTCAAGTAGTCGCGACTCGACTAAGAGCTCGAG
GAGCCTGTTTTCTCTGTCAAAGGCCCTGCCCAGGACGTCAAACACATCGGACGGTCAAGCGGAGAGCGTAAAAGG
CCCTCTTGGACTGAGTCTCCTATATTCCCCGACGGCACCGGAGATCGACTTCATCTTCGTCCATGGCCTAGGCGG
TAATTCTAGAAAAACATGGACCAAATCGTCTCTGCGGTATAATTTCTGGCCAAGGGAGTGGCTCTCCAAAGATCC
CGCATTCAAGAACGTCCGCATTCATAGCTATGGATACGATTCGTACTACTTGAAAGGAAAAGAGGACTGCTTGAA
TATACACCACATTAGCAAGTCATTCCTAGGTGCGATCAGCACTTCGCCATGCATTCTCAATTCTGGAACACACAT
CGTTGTCATCGGCCACAGCAAGGGTGGCTTAGTGATAAAGAAAGCATATATCCTGGCTAAACAAGACGAAGTGTA
CAAGGCGCTGGCTGGGCGATTCGCCGCATTCTATTTTCTCGCCACGCCGCATCGAGGTGCCGATTCGGCAAAGAT
TCTGAAGAACCTCCTCAAGGTTGCATACGACCGTGCTTATGTTGGCGATCTGGAACCAAATTCTGGGGCAGTCCA
AGTAATCAATGACGGATTTCGACATTTTTCGGCCGGCCTTGAGCTCTGGTCGTTCTACGAAACGTAGAATATGAA
AATGTTTAGCTCACTCATCGTCGATCCCGAGTCGGCCGTCCTCGGGTACCGTGAAGAGCAGCAGATACCCATGAC
TGCTGACCACCGCTCGATATGCAAGTTTGACACACCTGCAGACCCCAACTATGCCGTCCTCCGAAACGCGCTCGC
CTCTACTGTGAACAAAATCACCGCGGCAATTCCGGAGCTGAAACTGAAGCAGAGGCGTGAGAGAATCAAAAATCT
CAAGAAGTACCTGAAAGTTCCCGACATCTTAGACAATGATCTTACAAACGTCTGCGAAGCTCGGATGCATGGGAC
CTGCGGATGGATTTCGACCAAAGCCAGTCACGTCAAATGGAGAGATGGGGAATCCGGAAATGACAGGACACTATG
GATAAAGGGCAATCCAGCAACTGGAAAATCTGTTCTCGCTGGCTATGTCATCGATCAGCTCAAGGACTCTGGCCA
GACATGCAGCTACTTTTTCTTCAAACATGGAGACAAGTCGAAGTCCAACCTAGGTTGTTGTCTCCGATCTCTGGC
TTTTCAGATGGCTAGCTCTAATAGCGAAGCTAGTGATGCGATTCTAGGAATACAGGCGGATGGTGTTTGCTTAGA
TCGTGTCGACGAACATACCCTCTGGAGAATCCTCTTCCTTTCTGGCATTTTCCAGGCCACAATGACTCGGCATTT
CTGGGTCATCGACGCCCTAGACGAGTGTTTCAATCCTCCGGTCCTTTTATATGCCATTATTTCCAACATGGACGA
ATCTATACCCCTGAGAATTCTCATCACAAGTCGTATACGGTCGATCTGGACCAAGGTCTCTCGTTTATTGCACCC
GACCTGGTCCAGTCCTTGCCAATCTCGATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail