Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g1707.t1
Gene name
Locationscaffold_02:649991..652253
Strand-
Gene length (bp)2262
Transcript length (bp)2088
Coding sequence length (bp)2088
Protein length (aa) 696

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01756 ACOX Acyl-CoA oxidase 2.5E-46 511 675
PF14749 Acyl-CoA_ox_N Acyl-coenzyme A oxidase N-terminal 1.9E-27 33 147
PF02770 Acyl-CoA_dh_M Acyl-CoA dehydrogenase, middle domain 5.7E-12 149 259

GO

GO Term Description Terminal node
GO:0003997 acyl-CoA oxidase activity Yes
GO:0055114 oxidation-reduction process Yes
GO:0016627 oxidoreductase activity, acting on the CH-CH group of donors Yes
GO:0005777 peroxisome Yes
GO:0006635 fatty acid beta-oxidation Yes
GO:0009987 cellular process No
GO:0006631 fatty acid metabolic process No
GO:0046395 carboxylic acid catabolic process No
GO:0044238 primary metabolic process No
GO:0009056 catabolic process No
GO:0016042 lipid catabolic process No
GO:0009062 fatty acid catabolic process No
GO:0003824 catalytic activity No
GO:0072329 monocarboxylic acid catabolic process No
GO:0071704 organic substance metabolic process No
GO:1901575 organic substance catabolic process No
GO:0044444 cytoplasmic part No
GO:0016054 organic acid catabolic process No
GO:0044248 cellular catabolic process No
GO:0019752 carboxylic acid metabolic process No
GO:0019395 fatty acid oxidation No
GO:0043227 membrane-bounded organelle No
GO:0044464 cell part No
GO:0044237 cellular metabolic process No
GO:0016491 oxidoreductase activity No
GO:0044424 intracellular part No
GO:0044255 cellular lipid metabolic process No
GO:0006629 lipid metabolic process No
GO:0042579 microbody No
GO:0030258 lipid modification No
GO:0003674 molecular_function No
GO:0034440 lipid oxidation No
GO:0008150 biological_process No
GO:0044281 small molecule metabolic process No
GO:0008152 metabolic process No
GO:0044242 cellular lipid catabolic process No
GO:0006082 organic acid metabolic process No
GO:0005575 cellular_component No
GO:0043229 intracellular organelle No
GO:0016634 oxidoreductase activity, acting on the CH-CH group of donors, oxygen as acceptor No
GO:0044282 small molecule catabolic process No
GO:0032787 monocarboxylic acid metabolic process No
GO:0043436 oxoacid metabolic process No
GO:0043231 intracellular membrane-bounded organelle No
GO:0043226 organelle No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 13 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g1707.t1
MPSPPPDWVKALKPAGPQGSELLQQERAQSNVNVERLSELLHTKETLERRASILALLKPEKVFDKSQNHTLGRVE
RLQRSLGKAKRLQQLAEEHKWSMEELHAANDLIGEPTPYGLHASMFLVTLREQGTPEQRKLFLERAEKYEIIGCY
AQTELGHGSNVRGLETTATWNSDDKTFTINSPTLTSSKWWIGSLGRTANHAVVMAQLFIDGKNYGPHPFIVQVRD
LETHQPLDNVYVGDIGPKFGYNTMDNGFLLFNNVKIPHVNMLARFCQVDKETNRYTKPAVPSLVFGTMTWVRANI
VLDAGGVLARGVTIATRYCAVRRQFQDRDSDPNAGETQVLNYKMVQVRLLPLLASMYALHFTGRGMMRLYEENQS
RMKAASSPDQESRGAGPEQLRAGANLLADLHATSCGLKALASTTAGEGLEVCRRACGGHGYSSYSGIGPAYADYL
PTLTWEGDNYMLTQQVAQYLLKSARAVLAGKPADNDTSRILQTYLDRRDKGASFDVLDEDKDIVAAFAWRTAHLT
FEALKHRDAEKRSWNSLLVDFWRLSTSHSQYLVVKNFYEAVSSPELSAALDPETKGLLHQLFRLFSLHTLEREAA
EFFSSGAVTVRQITLTRTTAVLKLLDAIRPHAVRLVDAWAIPDWHLDSSLGRYDGKVYEDLFRRASEENPVNDLV
FDPYPWNSALLKNEPAKSKL*
Coding >Pro_DTO377G3_2|g1707.t1
ATGCCGTCACCTCCTCCTGATTGGGTTAAAGCCCTGAAGCCGGCAGGTCCGCAAGGATCTGAGCTCCTCCAGCAA
GAGCGTGCTCAATCGAATGTCAACGTCGAAAGATTATCCGAGTTGCTACACACAAAGGAAACTTTGGAGCGACGA
GCGTCCATCCTAGCTCTTTTGAAGCCCGAGAAAGTATTTGATAAGTCTCAGAACCATACTTTGGGCCGCGTAGAG
CGGCTCCAGCGATCGCTGGGCAAGGCCAAGCGCCTCCAGCAGCTTGCCGAAGAGCACAAATGGTCGATGGAAGAG
CTCCATGCGGCTAATGACTTGATTGGTGAACCTACCCCTTACGGTTTGCACGCTAGTATGTTCCTAGTGACTCTT
CGCGAGCAAGGAACTCCTGAGCAGCGCAAGCTGTTCCTTGAACGCGCAGAAAAATACGAGATTATCGGTTGCTAC
GCGCAAACAGAGCTGGGCCATGGATCGAACGTGCGCGGTTTGGAAACCACCGCCACCTGGAACTCCGACGATAAG
ACATTCACCATCAACTCTCCAACATTGACTTCTTCGAAGTGGTGGATTGGATCTCTCGGTCGCACGGCCAATCAC
GCTGTGGTTATGGCCCAGCTTTTTATTGATGGCAAGAACTATGGTCCTCACCCATTCATCGTGCAGGTCCGTGAC
CTCGAAACCCATCAACCATTGGATAATGTATATGTGGGCGATATTGGCCCCAAATTTGGCTACAACACTATGGAT
AATGGTTTCCTGCTGTTCAACAACGTCAAGATACCCCATGTGAACATGCTGGCCCGCTTCTGTCAGGTCGACAAA
GAGACGAACCGCTATACTAAGCCTGCTGTGCCATCTCTTGTCTTTGGTACTATGACCTGGGTGCGCGCCAACATT
GTTCTAGATGCCGGTGGTGTTCTGGCTCGCGGTGTGACTATCGCGACCCGTTACTGTGCGGTTCGGAGGCAGTTC
CAGGATCGCGATTCGGACCCGAACGCGGGTGAGACCCAAGTACTGAACTATAAGATGGTCCAGGTGCGCTTGCTT
CCACTTTTGGCATCTATGTATGCTCTTCATTTCACTGGTCGCGGTATGATGCGTCTGTATGAGGAGAATCAAAGC
CGCATGAAGGCAGCCAGTTCGCCCGACCAGGAGTCGCGGGGCGCTGGACCCGAGCAACTCCGTGCCGGTGCGAAC
CTCCTGGCGGATCTGCACGCCACCTCATGTGGTCTTAAGGCTCTCGCCAGTACCACTGCCGGTGAGGGTCTGGAG
GTCTGCCGCCGCGCCTGTGGTGGTCACGGATACAGCAGCTACAGCGGCATTGGACCGGCTTACGCAGATTATCTG
CCCACACTGACTTGGGAAGGTGATAACTATATGTTGACCCAGCAGGTTGCACAATATCTTCTCAAATCTGCCCGT
GCCGTCCTGGCCGGTAAGCCGGCTGATAACGACACTAGCCGCATTCTTCAGACATACCTCGACCGTCGCGACAAG
GGAGCTTCATTCGATGTGCTCGATGAAGACAAGGACATTGTGGCTGCCTTTGCCTGGCGCACAGCTCATCTGACC
TTCGAGGCCCTCAAGCATCGGGATGCTGAGAAGCGCTCCTGGAACAGCCTTTTGGTTGACTTCTGGCGCTTGTCT
ACGTCTCATTCTCAGTACCTGGTGGTGAAGAACTTCTACGAGGCGGTTTCCTCCCCTGAACTCTCAGCGGCCTTG
GATCCAGAGACCAAGGGCCTCCTGCATCAATTATTCAGACTCTTCTCGCTGCACACTCTAGAGCGTGAAGCCGCC
GAGTTCTTCTCTTCCGGTGCGGTTACTGTGCGACAAATTACCTTGACTCGTACTACTGCCGTATTAAAGCTACTC
GACGCGATCCGCCCGCACGCTGTCCGATTGGTCGATGCTTGGGCGATTCCCGACTGGCACCTGGACAGCAGCCTG
GGTCGCTATGACGGCAAGGTGTACGAGGATCTGTTCCGCCGCGCAAGCGAGGAGAACCCTGTTAACGACTTGGTG
TTTGACCCTTACCCATGGAACTCGGCATTGCTCAAGAATGAGCCAGCCAAGAGCAAGCTGTAA
Transcript >Pro_DTO377G3_2|g1707.t1
ATGCCGTCACCTCCTCCTGATTGGGTTAAAGCCCTGAAGCCGGCAGGTCCGCAAGGATCTGAGCTCCTCCAGCAA
GAGCGTGCTCAATCGAATGTCAACGTCGAAAGATTATCCGAGTTGCTACACACAAAGGAAACTTTGGAGCGACGA
GCGTCCATCCTAGCTCTTTTGAAGCCCGAGAAAGTATTTGATAAGTCTCAGAACCATACTTTGGGCCGCGTAGAG
CGGCTCCAGCGATCGCTGGGCAAGGCCAAGCGCCTCCAGCAGCTTGCCGAAGAGCACAAATGGTCGATGGAAGAG
CTCCATGCGGCTAATGACTTGATTGGTGAACCTACCCCTTACGGTTTGCACGCTAGTATGTTCCTAGTGACTCTT
CGCGAGCAAGGAACTCCTGAGCAGCGCAAGCTGTTCCTTGAACGCGCAGAAAAATACGAGATTATCGGTTGCTAC
GCGCAAACAGAGCTGGGCCATGGATCGAACGTGCGCGGTTTGGAAACCACCGCCACCTGGAACTCCGACGATAAG
ACATTCACCATCAACTCTCCAACATTGACTTCTTCGAAGTGGTGGATTGGATCTCTCGGTCGCACGGCCAATCAC
GCTGTGGTTATGGCCCAGCTTTTTATTGATGGCAAGAACTATGGTCCTCACCCATTCATCGTGCAGGTCCGTGAC
CTCGAAACCCATCAACCATTGGATAATGTATATGTGGGCGATATTGGCCCCAAATTTGGCTACAACACTATGGAT
AATGGTTTCCTGCTGTTCAACAACGTCAAGATACCCCATGTGAACATGCTGGCCCGCTTCTGTCAGGTCGACAAA
GAGACGAACCGCTATACTAAGCCTGCTGTGCCATCTCTTGTCTTTGGTACTATGACCTGGGTGCGCGCCAACATT
GTTCTAGATGCCGGTGGTGTTCTGGCTCGCGGTGTGACTATCGCGACCCGTTACTGTGCGGTTCGGAGGCAGTTC
CAGGATCGCGATTCGGACCCGAACGCGGGTGAGACCCAAGTACTGAACTATAAGATGGTCCAGGTGCGCTTGCTT
CCACTTTTGGCATCTATGTATGCTCTTCATTTCACTGGTCGCGGTATGATGCGTCTGTATGAGGAGAATCAAAGC
CGCATGAAGGCAGCCAGTTCGCCCGACCAGGAGTCGCGGGGCGCTGGACCCGAGCAACTCCGTGCCGGTGCGAAC
CTCCTGGCGGATCTGCACGCCACCTCATGTGGTCTTAAGGCTCTCGCCAGTACCACTGCCGGTGAGGGTCTGGAG
GTCTGCCGCCGCGCCTGTGGTGGTCACGGATACAGCAGCTACAGCGGCATTGGACCGGCTTACGCAGATTATCTG
CCCACACTGACTTGGGAAGGTGATAACTATATGTTGACCCAGCAGGTTGCACAATATCTTCTCAAATCTGCCCGT
GCCGTCCTGGCCGGTAAGCCGGCTGATAACGACACTAGCCGCATTCTTCAGACATACCTCGACCGTCGCGACAAG
GGAGCTTCATTCGATGTGCTCGATGAAGACAAGGACATTGTGGCTGCCTTTGCCTGGCGCACAGCTCATCTGACC
TTCGAGGCCCTCAAGCATCGGGATGCTGAGAAGCGCTCCTGGAACAGCCTTTTGGTTGACTTCTGGCGCTTGTCT
ACGTCTCATTCTCAGTACCTGGTGGTGAAGAACTTCTACGAGGCGGTTTCCTCCCCTGAACTCTCAGCGGCCTTG
GATCCAGAGACCAAGGGCCTCCTGCATCAATTATTCAGACTCTTCTCGCTGCACACTCTAGAGCGTGAAGCCGCC
GAGTTCTTCTCTTCCGGTGCGGTTACTGTGCGACAAATTACCTTGACTCGTACTACTGCCGTATTAAAGCTACTC
GACGCGATCCGCCCGCACGCTGTCCGATTGGTCGATGCTTGGGCGATTCCCGACTGGCACCTGGACAGCAGCCTG
GGTCGCTATGACGGCAAGGTGTACGAGGATCTGTTCCGCCGCGCAAGCGAGGAGAACCCTGTTAACGACTTGGTG
TTTGACCCTTACCCATGGAACTCGGCATTGCTCAAGAATGAGCCAGCCAAGAGCAAGCTGTAA
Gene >Pro_DTO377G3_2|g1707.t1
ATGCCGTCACCTCCTCCTGATTGGGTTAAAGCCCTGAAGCCGGCAGGTCCGCAAGGATCTGAGCTCCTCCAGCAA
GAGCGTGCTCAATCGAATGTCAACGTCGAAAGATTATCCGAGTTGCTACACACAAAGGAAACTTTGGAGCGACGA
GCGTCCATCCTAGCTCTTTTGAAGCCCGAGAAAGTATTTGATAAGTCTCAGAACCATACTTTGGGCCGCGTAGAG
CGGCTCCAGCGATCGCTGGGCAAGGCCAAGCGCCTCCAGCAGCTTGCCGAAGAGCACAAATGGTCGATGGAAGAG
CTCCATGCGGCTAATGACTTGATTGGTGAACCTACCCCTTACGGTTTGCACGCTAGTATGTTCCTAGTAAGTGAA
TTAGACCCTTGTCAATAATCCAACTCTCCAACTAAACTAACCACTTTGGTCGTTATCTAGGTGACTCTTCGCGAG
CAAGGAACTCCTGAGCAGCGCAAGCTGTTCCTTGAACGCGCAGAAAAATACGAGATTATCGGTTGCTACGCGCAA
ACAGAGCTGGGCCATGGATCGAACGTGCGCGGTTTGGAAACCACCGCCACCTGGAACTCCGACGATAAGACATTC
ACCATCAACTCTCCAACATTGACTTCTTCGAAGTGGTGGATTGGATCTCTCGGTCGCACGGCCAATCACGCTGTG
GTTATGGCCCAGCTTTTTATTGATGGCAAGAACTATGGTCCTCACCCATTCATCGTGCAGGTCCGTGACCTCGAA
ACCCATCAACCATTGGATAATGTATATGTGGGCGATATTGGCCCCAAATTTGGCTACAAGTAAGTCGGCTCTCAT
TTTTTGGCCGGTATCAGCACTAATGACTACTTAGCACTATGGATAATGGTTTCCTGCTGTTCAACAACGTCAAGA
TACCCCATGTGAACATGCTGGCCCGCTTCTGTCAGGTCGACAAAGAGACGAACCGCTATACTAAGCCTGCTGTGC
CATCTCTTGTCTTTGGTACTATGACCTGGGTGCGCGCCAACATTGTTCTAGATGCCGGTGGTGTTCTGGCTCGCG
GTGTGACTATCGCGACCCGTTACTGTGCGGTTCGGAGGCAGTTCCAGGATCGCGATTCGGACCCGAACGCGGGTG
AGACCCAAGTACTGAACTATAAGATGGTCCAGGTGCGCTTGCTTCCACTTTTGGCATCTATGTATGCTCTTCATT
TCACTGGTCGCGGTATGATGCGTCTGTATGAGGAGAATCAAAGCCGCATGAAGGCAGCCAGTTCGCCCGACCAGG
AGTCGCGGGGCGCTGGACCCGAGCAACTCCGTGCCGGTGCGAACCTCCTGGCGGATCTGCACGCCACCTCATGTG
GTCTTAAGGCTCTCGCCAGTACCACTGCCGGTGAGGGTCTGGAGGTCTGCCGCCGCGCCTGTGGTGGTCACGGAT
ACAGCAGCTACAGCGGCATTGGACCGGCTTACGCAGATTATCTGCCCACACTGACTTGGGAAGGTGATAACTATA
TGTTGACCCAGCAGGTTGCACAATATGTATGTCGCAGTTCTTTCTTCCATTCTATTTACTCCTAACTGACCGTAT
TAATAGCTTCTCAAATCTGCCCGTGCCGTCCTGGCCGGTAAGCCGGCTGATAACGACACTAGCCGCATTCTTCAG
ACATACCTCGACCGTCGCGACAAGGGAGCTTCATTCGATGTGCTCGATGAAGACAAGGACATTGTGGCTGCCTTT
GCCTGGCGCACAGCTCATCTGACCTTCGAGGCCCTCAAGCATCGGGATGCTGAGAAGCGCTCCTGGAACAGCCTT
TTGGTTGACTTCTGGCGCTTGTCTACGTCTCATTCTCAGTACCTGGTGGTGAAGAACTTCTACGAGGCGGTTTCC
TCCCCTGAACTCTCAGCGGCCTTGGATCCAGAGACCAAGGGCCTCCTGCATCAATTATTCAGACTCTTCTCGCTG
CACACTCTAGAGCGTGAAGCCGCCGAGTTCTTCTCTTCCGGTGCGGTTACTGTGCGACAAATTACCTTGACTCGT
ACTACTGCCGTATTAAAGCTACTCGACGCGATCCGCCCGCACGCTGTCCGATTGGTCGATGCTTGGGCGATTCCC
GACTGGCACCTGGACAGCAGCCTGGGTCGCTATGACGGCAAGGTGTACGAGGATCTGTTCCGCCGCGCAAGCGAG
GAGAACCCTGTTAACGACTTGGTGTTTGACCCTTACCCATGGAACTCGGCATTGCTCAAGAATGAGCCAGCCAAG
AGCAAGCTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail