Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g1693.t1
Gene name
Locationscaffold_02:606540..612451
Strand+
Gene length (bp)5911
Transcript length (bp)5760
Coding sequence length (bp)5760
Protein length (aa) 1920

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01369 Sec7 Sec7 domain 4.3E-69 733 916
PF12783 Sec7_N Guanine nucleotide exchange factor in Golgi transport N-terminal 4.6E-41 406 576
PF09324 DUF1981 Domain of unknown function (DUF1981) 6.9E-33 1278 1360
PF16213 DCB Dimerisation and cyclophilin-binding domain of Mon2 9.8E-16 148 305

GO

GO Term Description Terminal node
GO:0005086 ARF guanyl-nucleotide exchange factor activity Yes
GO:0032012 regulation of ARF protein signal transduction Yes
GO:0065007 biological regulation No
GO:0005085 guanyl-nucleotide exchange factor activity No
GO:0050794 regulation of cellular process No
GO:0003674 molecular_function No
GO:0050789 regulation of biological process No
GO:0019899 enzyme binding No
GO:0098772 molecular function regulator No
GO:0051020 GTPase binding No
GO:0048583 regulation of response to stimulus No
GO:1902531 regulation of intracellular signal transduction No
GO:0005488 binding No
GO:0009966 regulation of signal transduction No
GO:0010646 regulation of cell communication No
GO:0005515 protein binding No
GO:0051056 regulation of small GTPase mediated signal transduction No
GO:0046578 regulation of Ras protein signal transduction No
GO:0008150 biological_process No
GO:0023051 regulation of signaling No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 60 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g1693.t1
MADTEVGSEPTQSIAMPEKSVETPDTSSTVPNSDEPTLPEQTESEEPNQESDEGVAEVQEDEEKSEVPSKHEPEQ
TEQEPQTDGPPTIQEPPHEDNTATESRWRSDSRSTTATFMTQRSSPVSSTVFIVTALDNIAASRDARRDKKLEDA
TQVALANIRQPDGQAIDPELIFRPLHLASKALSIPLQVTALDCIGKLITYSYFAFPSAATDNNATREQPPLIERA
IDAICECFENEATAVEIQQQIIKSLLAAVLNDKIVVHGAGLLKAVRQIYNIFIYSKSSQNQQIAQGSLTQMVSTV
FDRVRTRMDLKELRVRELENPSSTLDTSASDVGQNSETADQPVIKEPTAEKLTLQSFESPNEVTTVNDNAPTTVT
RAKRSTTRSMSGIPEEKDDDSSAEDDVDEIYVKDAFLVFRALCKLSHKVLTHEQQQDVKSQNMRSKLLSLHLIHY
LINNHTATFLSPLAAIKNSSSSVDGMNLLLAVRPHLCLSLSRNGSSAVPHVFKVCCEIFWLMLKDMRVMMKKELE
VFLKEIYLAILEKRGAPTFQKQYFMEILERLGGDPRALVEIYLNYDCDRTALENIFQNIIEQLSRYSSVPVVTTP
SQQHQYQEQHTKMSAIGSEWHHRGNLPPSLTSAHIAPTPPSSMPHIPPEYGLKQQGLECLVEILRSLDNWATHRI
DELPEAAIPSKSIDNSRESLDTSVLVSPHLESFESGTGRSTPMPEDDPNQIEKVKQRKIALTNAVQQFNFKPKRG
IKAFLKEGFIKSESPEEIASFLLRTDRIDKAMLGEYLGEGDQQNIAIMHAFVDLMEFTKRRFVESLRSFLQHFRL
PGEAQKIDRFMLKFAERYTTQNPNAFANADTAYVLAYSVILLNTDQHSSKMKGRRMTKEDFIKNNRGINDNQDLP
AEYLGTIYEEIGSNEIVLYTEQEHAANFNPPPPAPTGLATRAGQVFATVGRDIQGEKYAQASEEMANKTEQLYRS
LIRAQRKTAVKDALSHFIPATSDRHVGSMFNVTWMSFLSGLSAPMQDTSNLETIRLCMEGLKLSIRISCAFDLET
PRVAFVTALAKFTNLGNVREMMAKNVEALRALLDIAFTEGNHLQGSWRDVLTCVSQLDRLQLLSDGVDEGSLPDV
SRAPSALSRTPSSADTSRRSTQSTRRPRPRSVNGPTAFRPEIAMESRSADMIRGVDRIFTNTANLSHEAIIDFVR
ALSEVSWQEIQSSGHTDSPRTYSLQKLVEISYYNMTRVRIEWSKIWDVLGQHFNQVGCHSNTMVVFFALDSLRQL
SMRFLEIEELPGFKFQKDFLKPFEHVMANSTTAAVKDMILRCLIQMIQARGDNIRSGWKTMFGVFTVAAREPYEG
IVNMAFDHVTQVYNTRFGVVITQGAFADLIVCLTEFSKNSKFQKKSLQAIETLRSTVTKMLRTPECPLSHRGASA
AIFQDNGTNLAKQLTRQSQEEQFWYPILIAFQDVLMTGDDLEVRSRALTYLFDTLIRHGGDFPRDFWDVLWRQLL
YPIFVVLQSKSEMSKVPNHEDLSVWLSTTMIQALRNMITLFTHYFDALEYMLSRFLELLILCICQENDTIARIGS
NCLQQLILQNVAKFKPEHWSQIVGAFVELFSKTTAYELFTAAASISKPTEAVNGDLTQSPDAAVATKEMPDALQP
NGSQSASSLHDPPVQSEARAELEDYRPHSDQQQPAAVTAARRRYFNRIITNCVLQLLMIETVHELFSNENVYAQI
PSGELLRLMGLLKKSYQFAKKFNEDKDLRMQLWRQGFMKQPPNLLKQESGSASTYVHILFRMYHDEREERQSSRA
ETEAALIPLCADIIRSFVRLEEDTQHRNIVAWRPVVVDVIDGYTNFPQDDFNKHIEAFYPLGVELLSRDLNPEIR
VALQSLLRRTGEVRLGIAPPNPLDVPISPRSSVSQKASRRDSQV*
Coding >Pro_DTO377G3_2|g1693.t1
ATGGCGGACACCGAAGTCGGCTCAGAGCCGACCCAATCCATTGCAATGCCTGAGAAATCCGTCGAGACCCCCGAC
ACATCTTCTACAGTACCAAACTCCGACGAGCCAACACTGCCCGAGCAGACCGAATCGGAAGAACCAAACCAGGAG
AGCGACGAGGGAGTAGCCGAGGTCCAGGAAGATGAAGAAAAATCAGAGGTCCCGTCTAAGCACGAGCCTGAACAA
ACTGAACAAGAACCGCAAACAGACGGTCCGCCTACGATCCAGGAACCCCCCCACGAGGACAACACTGCGACAGAA
AGCAGATGGCGATCGGATTCGCGGTCAACAACGGCTACGTTTATGACGCAGCGATCTAGCCCAGTCAGCTCGACG
GTCTTTATTGTGACGGCTCTGGACAATATCGCTGCTTCGCGGGACGCCCGGAGGGACAAAAAGCTGGAGGATGCC
ACACAGGTGGCCCTGGCCAATATCAGACAACCTGATGGGCAAGCCATTGATCCGGAGCTTATCTTCCGTCCTCTA
CACCTGGCAAGCAAAGCCCTGAGCATTCCTCTACAAGTGACTGCATTGGACTGCATTGGAAAGCTGATCACATAC
TCCTATTTCGCGTTTCCATCTGCCGCGACAGACAACAATGCCACGCGCGAACAACCTCCTCTTATTGAGCGTGCT
ATTGATGCGATCTGCGAATGCTTCGAGAATGAAGCAACGGCCGTTGAGATCCAACAGCAGATCATCAAATCGCTA
TTGGCAGCGGTCTTGAACGACAAGATCGTGGTGCATGGAGCTGGTCTCCTGAAAGCCGTCCGCCAAATCTATAAC
ATCTTTATCTACTCCAAATCCAGTCAAAACCAGCAGATCGCTCAGGGGTCGCTCACACAAATGGTCAGCACGGTC
TTTGATCGCGTGCGGACACGGATGGATCTTAAAGAGCTCCGAGTGCGAGAGCTAGAAAATCCATCCTCGACCCTT
GATACATCGGCGAGTGACGTGGGCCAAAACTCGGAGACGGCTGATCAGCCCGTCATTAAAGAGCCCACTGCTGAG
AAGCTCACCCTACAGAGTTTTGAGTCGCCTAACGAGGTTACCACTGTCAACGATAATGCGCCGACTACAGTCACG
CGTGCTAAGCGGTCAACGACGAGGTCAATGTCGGGTATCCCCGAGGAAAAAGATGATGATAGCTCGGCCGAGGAC
GATGTGGACGAGATTTACGTCAAGGATGCTTTTTTGGTCTTCCGAGCGCTCTGCAAATTGAGCCACAAGGTTCTG
ACTCACGAGCAGCAACAAGATGTCAAATCCCAGAACATGAGGTCGAAGCTACTTTCACTGCACTTGATTCACTAC
CTCATCAACAACCACACCGCAACCTTTCTATCCCCTCTGGCAGCAATCAAGAACAGCTCATCCAGCGTGGATGGA
ATGAATCTCCTGCTAGCTGTACGACCTCATTTGTGTCTAAGTTTAAGTCGCAATGGTTCTAGCGCTGTGCCTCAT
GTCTTCAAAGTCTGTTGTGAAATCTTCTGGCTGATGTTGAAGGACATGAGAGTCATGATGAAAAAGGAACTCGAG
GTGTTCTTGAAAGAAATTTATCTCGCCATTCTCGAGAAGCGCGGGGCTCCTACGTTCCAAAAGCAGTACTTCATG
GAGATTCTGGAGAGGCTAGGTGGTGATCCACGGGCTCTGGTTGAAATCTATCTCAACTACGACTGTGACAGAACC
GCTTTGGAGAATATATTCCAAAATATCATTGAGCAATTGTCCCGGTACTCAAGCGTGCCGGTTGTAACAACACCT
TCACAGCAGCATCAGTACCAAGAACAACACACTAAAATGTCAGCCATTGGTTCTGAATGGCACCATCGAGGAAAT
CTTCCTCCTTCCTTGACAAGTGCACACATTGCCCCTACTCCGCCGTCCTCGATGCCTCATATTCCACCGGAGTAC
GGATTGAAACAGCAGGGTTTGGAGTGTCTTGTGGAGATACTGCGCTCACTGGACAACTGGGCCACACATCGCATC
GATGAACTGCCCGAGGCGGCCATTCCCTCTAAATCGATAGATAACTCCCGTGAGTCCTTGGACACAAGCGTGCTT
GTTTCACCGCATCTGGAGTCCTTCGAGAGTGGGACTGGCCGGTCCACACCTATGCCCGAAGACGACCCAAACCAG
ATTGAAAAAGTCAAGCAACGAAAAATCGCTCTCACAAATGCCGTCCAACAATTTAATTTCAAGCCCAAGCGTGGC
ATCAAGGCCTTCCTGAAAGAAGGTTTCATCAAATCCGAGTCTCCCGAAGAAATTGCCAGCTTCCTACTTCGCACA
GACCGTATTGACAAGGCCATGCTGGGAGAGTATCTTGGTGAGGGAGACCAGCAAAACATTGCTATCATGCATGCT
TTTGTTGATTTGATGGAATTCACGAAGCGACGCTTCGTTGAATCCCTGCGCTCGTTTTTGCAGCATTTCCGCCTC
CCTGGTGAAGCCCAAAAGATCGATCGGTTTATGCTGAAGTTTGCCGAACGGTATACAACTCAAAACCCCAATGCC
TTCGCTAACGCTGACACTGCATATGTGCTTGCGTACTCGGTGATTCTCCTCAACACAGATCAACACAGTTCGAAA
ATGAAGGGCCGCCGTATGACCAAGGAGGACTTTATCAAGAACAACCGCGGGATCAATGACAACCAGGATCTACCG
GCCGAATATCTTGGGACCATTTATGAGGAGATTGGAAGTAATGAAATCGTGCTATACACCGAGCAGGAACATGCC
GCCAACTTCAACCCTCCACCCCCGGCTCCCACTGGCCTTGCAACCAGGGCTGGACAGGTGTTTGCGACTGTTGGA
CGAGACATCCAGGGTGAGAAATACGCACAGGCTTCTGAGGAAATGGCGAACAAGACAGAACAGCTCTATCGTTCC
CTTATTCGAGCCCAGCGCAAGACAGCAGTTAAAGATGCGCTTTCGCACTTCATTCCCGCGACATCAGATCGTCAT
GTCGGGTCAATGTTCAACGTCACATGGATGTCTTTCCTATCTGGTCTGTCTGCACCGATGCAAGACACGTCCAAC
CTGGAAACCATCCGGCTCTGCATGGAGGGACTTAAACTGTCCATCCGGATTAGCTGTGCCTTCGACCTAGAGACT
CCTCGCGTGGCCTTTGTGACTGCCTTGGCGAAGTTCACTAACCTCGGAAACGTGAGGGAGATGATGGCCAAAAAT
GTGGAGGCACTGAGAGCTTTGCTCGACATCGCCTTCACCGAGGGCAACCACCTCCAGGGCTCGTGGAGGGATGTT
TTGACATGTGTCAGTCAACTTGATCGGCTCCAACTCTTGAGTGATGGAGTCGATGAGGGGTCGCTGCCTGATGTT
TCAAGGGCACCTTCAGCACTTTCTAGGACGCCTTCATCAGCAGATACCTCCCGCAGATCTACGCAAAGTACACGA
CGCCCTCGCCCTCGCTCTGTGAATGGGCCAACCGCTTTCCGCCCAGAAATTGCCATGGAGAGCCGTTCGGCAGAT
ATGATTCGTGGCGTGGACCGTATCTTTACCAACACTGCTAATCTGTCGCATGAGGCAATTATTGACTTCGTTCGG
GCCTTGAGCGAGGTCAGCTGGCAAGAAATCCAATCTTCCGGTCACACCGATTCGCCCCGAACCTACAGTCTGCAG
AAGCTCGTCGAGATCAGCTACTACAACATGACTCGGGTCAGGATTGAGTGGTCTAAGATTTGGGATGTTTTGGGC
CAGCACTTTAATCAAGTTGGCTGCCACTCTAATACCATGGTTGTCTTCTTTGCCTTGGATTCGCTCCGGCAACTT
TCGATGCGCTTCTTGGAGATTGAGGAGTTGCCTGGTTTCAAGTTCCAAAAGGACTTCCTTAAGCCTTTTGAGCAT
GTGATGGCAAACAGCACCACTGCTGCTGTTAAGGATATGATTCTGCGGTGTCTGATCCAGATGATCCAGGCCCGT
GGCGACAATATTCGTTCGGGATGGAAGACTATGTTTGGTGTCTTTACGGTCGCAGCACGGGAACCCTATGAGGGA
ATCGTGAACATGGCTTTTGACCATGTCACCCAAGTATACAATACCAGATTTGGCGTAGTAATCACCCAAGGTGCC
TTTGCAGATCTCATCGTATGCCTGACTGAATTCTCAAAGAACTCCAAGTTCCAAAAGAAATCACTGCAGGCAATT
GAGACCCTCAGGTCTACCGTCACCAAAATGCTACGGACTCCAGAATGTCCCTTGTCACACCGTGGTGCTTCGGCG
GCCATCTTCCAGGACAATGGAACCAATCTTGCTAAACAACTTACCCGTCAATCACAAGAGGAGCAGTTCTGGTAT
CCGATTCTCATCGCATTCCAGGATGTACTCATGACGGGGGATGATCTCGAGGTCCGCTCACGGGCACTCACATAC
CTCTTTGATACGCTAATCCGTCATGGTGGCGATTTCCCCAGGGACTTTTGGGATGTCCTTTGGAGACAGCTCCTC
TACCCGATCTTTGTTGTCCTGCAGTCTAAGTCCGAAATGTCCAAGGTTCCGAACCACGAGGATCTTTCAGTCTGG
CTGTCCACGACAATGATCCAGGCGCTACGGAACATGATCACTTTGTTCACGCACTATTTCGATGCACTGGAGTAC
ATGCTGAGCCGCTTCTTGGAACTGCTGATATTATGCATTTGTCAAGAAAATGACACGATTGCACGAATTGGCAGC
AATTGCCTGCAACAGCTGATTTTGCAGAATGTTGCAAAGTTCAAGCCGGAGCACTGGTCCCAGATTGTTGGGGCA
TTCGTGGAGCTTTTCAGCAAAACGACCGCCTACGAACTTTTCACGGCTGCTGCATCGATATCTAAGCCGACAGAG
GCAGTTAATGGGGACCTCACCCAATCTCCAGATGCTGCTGTAGCAACAAAAGAGATGCCTGATGCATTGCAGCCT
AACGGATCCCAAAGCGCATCTTCTCTCCATGATCCTCCTGTCCAAAGTGAAGCCCGCGCCGAATTGGAAGACTAT
CGCCCTCACTCAGACCAGCAGCAACCTGCGGCTGTCACTGCAGCTCGGCGCCGTTACTTCAACCGCATCATCACG
AACTGCGTTCTCCAGCTGCTCATGATTGAAACGGTCCACGAACTTTTCTCGAACGAAAATGTCTATGCACAGATT
CCCAGTGGAGAGCTCCTGCGGCTCATGGGGCTGCTGAAAAAGAGTTATCAGTTCGCGAAGAAGTTCAACGAGGAT
AAGGACTTGCGAATGCAACTCTGGCGCCAGGGATTCATGAAGCAACCTCCTAATCTATTGAAGCAGGAGAGCGGT
AGTGCCTCTACCTACGTGCATATCCTCTTCCGAATGTATCACGACGAGCGAGAGGAAAGACAGAGCAGTCGCGCA
GAGACCGAGGCTGCACTCATTCCACTCTGCGCGGATATTATTCGCAGTTTCGTTCGCCTTGAAGAGGACACCCAG
CACCGCAACATCGTCGCTTGGCGTCCGGTTGTGGTCGATGTCATTGATGGATATACTAACTTCCCGCAAGATGAC
TTTAATAAGCATATTGAGGCCTTTTACCCTCTCGGAGTTGAGCTTCTGAGCCGTGATCTCAATCCGGAGATTCGC
GTTGCCCTCCAGTCTCTACTGCGCCGGACCGGCGAGGTCCGACTAGGCATTGCTCCGCCCAATCCCCTAGACGTC
CCCATCAGCCCGCGCAGCTCCGTCTCCCAGAAAGCCTCGCGCCGCGATAGCCAGGTCTGA
Transcript >Pro_DTO377G3_2|g1693.t1
ATGGCGGACACCGAAGTCGGCTCAGAGCCGACCCAATCCATTGCAATGCCTGAGAAATCCGTCGAGACCCCCGAC
ACATCTTCTACAGTACCAAACTCCGACGAGCCAACACTGCCCGAGCAGACCGAATCGGAAGAACCAAACCAGGAG
AGCGACGAGGGAGTAGCCGAGGTCCAGGAAGATGAAGAAAAATCAGAGGTCCCGTCTAAGCACGAGCCTGAACAA
ACTGAACAAGAACCGCAAACAGACGGTCCGCCTACGATCCAGGAACCCCCCCACGAGGACAACACTGCGACAGAA
AGCAGATGGCGATCGGATTCGCGGTCAACAACGGCTACGTTTATGACGCAGCGATCTAGCCCAGTCAGCTCGACG
GTCTTTATTGTGACGGCTCTGGACAATATCGCTGCTTCGCGGGACGCCCGGAGGGACAAAAAGCTGGAGGATGCC
ACACAGGTGGCCCTGGCCAATATCAGACAACCTGATGGGCAAGCCATTGATCCGGAGCTTATCTTCCGTCCTCTA
CACCTGGCAAGCAAAGCCCTGAGCATTCCTCTACAAGTGACTGCATTGGACTGCATTGGAAAGCTGATCACATAC
TCCTATTTCGCGTTTCCATCTGCCGCGACAGACAACAATGCCACGCGCGAACAACCTCCTCTTATTGAGCGTGCT
ATTGATGCGATCTGCGAATGCTTCGAGAATGAAGCAACGGCCGTTGAGATCCAACAGCAGATCATCAAATCGCTA
TTGGCAGCGGTCTTGAACGACAAGATCGTGGTGCATGGAGCTGGTCTCCTGAAAGCCGTCCGCCAAATCTATAAC
ATCTTTATCTACTCCAAATCCAGTCAAAACCAGCAGATCGCTCAGGGGTCGCTCACACAAATGGTCAGCACGGTC
TTTGATCGCGTGCGGACACGGATGGATCTTAAAGAGCTCCGAGTGCGAGAGCTAGAAAATCCATCCTCGACCCTT
GATACATCGGCGAGTGACGTGGGCCAAAACTCGGAGACGGCTGATCAGCCCGTCATTAAAGAGCCCACTGCTGAG
AAGCTCACCCTACAGAGTTTTGAGTCGCCTAACGAGGTTACCACTGTCAACGATAATGCGCCGACTACAGTCACG
CGTGCTAAGCGGTCAACGACGAGGTCAATGTCGGGTATCCCCGAGGAAAAAGATGATGATAGCTCGGCCGAGGAC
GATGTGGACGAGATTTACGTCAAGGATGCTTTTTTGGTCTTCCGAGCGCTCTGCAAATTGAGCCACAAGGTTCTG
ACTCACGAGCAGCAACAAGATGTCAAATCCCAGAACATGAGGTCGAAGCTACTTTCACTGCACTTGATTCACTAC
CTCATCAACAACCACACCGCAACCTTTCTATCCCCTCTGGCAGCAATCAAGAACAGCTCATCCAGCGTGGATGGA
ATGAATCTCCTGCTAGCTGTACGACCTCATTTGTGTCTAAGTTTAAGTCGCAATGGTTCTAGCGCTGTGCCTCAT
GTCTTCAAAGTCTGTTGTGAAATCTTCTGGCTGATGTTGAAGGACATGAGAGTCATGATGAAAAAGGAACTCGAG
GTGTTCTTGAAAGAAATTTATCTCGCCATTCTCGAGAAGCGCGGGGCTCCTACGTTCCAAAAGCAGTACTTCATG
GAGATTCTGGAGAGGCTAGGTGGTGATCCACGGGCTCTGGTTGAAATCTATCTCAACTACGACTGTGACAGAACC
GCTTTGGAGAATATATTCCAAAATATCATTGAGCAATTGTCCCGGTACTCAAGCGTGCCGGTTGTAACAACACCT
TCACAGCAGCATCAGTACCAAGAACAACACACTAAAATGTCAGCCATTGGTTCTGAATGGCACCATCGAGGAAAT
CTTCCTCCTTCCTTGACAAGTGCACACATTGCCCCTACTCCGCCGTCCTCGATGCCTCATATTCCACCGGAGTAC
GGATTGAAACAGCAGGGTTTGGAGTGTCTTGTGGAGATACTGCGCTCACTGGACAACTGGGCCACACATCGCATC
GATGAACTGCCCGAGGCGGCCATTCCCTCTAAATCGATAGATAACTCCCGTGAGTCCTTGGACACAAGCGTGCTT
GTTTCACCGCATCTGGAGTCCTTCGAGAGTGGGACTGGCCGGTCCACACCTATGCCCGAAGACGACCCAAACCAG
ATTGAAAAAGTCAAGCAACGAAAAATCGCTCTCACAAATGCCGTCCAACAATTTAATTTCAAGCCCAAGCGTGGC
ATCAAGGCCTTCCTGAAAGAAGGTTTCATCAAATCCGAGTCTCCCGAAGAAATTGCCAGCTTCCTACTTCGCACA
GACCGTATTGACAAGGCCATGCTGGGAGAGTATCTTGGTGAGGGAGACCAGCAAAACATTGCTATCATGCATGCT
TTTGTTGATTTGATGGAATTCACGAAGCGACGCTTCGTTGAATCCCTGCGCTCGTTTTTGCAGCATTTCCGCCTC
CCTGGTGAAGCCCAAAAGATCGATCGGTTTATGCTGAAGTTTGCCGAACGGTATACAACTCAAAACCCCAATGCC
TTCGCTAACGCTGACACTGCATATGTGCTTGCGTACTCGGTGATTCTCCTCAACACAGATCAACACAGTTCGAAA
ATGAAGGGCCGCCGTATGACCAAGGAGGACTTTATCAAGAACAACCGCGGGATCAATGACAACCAGGATCTACCG
GCCGAATATCTTGGGACCATTTATGAGGAGATTGGAAGTAATGAAATCGTGCTATACACCGAGCAGGAACATGCC
GCCAACTTCAACCCTCCACCCCCGGCTCCCACTGGCCTTGCAACCAGGGCTGGACAGGTGTTTGCGACTGTTGGA
CGAGACATCCAGGGTGAGAAATACGCACAGGCTTCTGAGGAAATGGCGAACAAGACAGAACAGCTCTATCGTTCC
CTTATTCGAGCCCAGCGCAAGACAGCAGTTAAAGATGCGCTTTCGCACTTCATTCCCGCGACATCAGATCGTCAT
GTCGGGTCAATGTTCAACGTCACATGGATGTCTTTCCTATCTGGTCTGTCTGCACCGATGCAAGACACGTCCAAC
CTGGAAACCATCCGGCTCTGCATGGAGGGACTTAAACTGTCCATCCGGATTAGCTGTGCCTTCGACCTAGAGACT
CCTCGCGTGGCCTTTGTGACTGCCTTGGCGAAGTTCACTAACCTCGGAAACGTGAGGGAGATGATGGCCAAAAAT
GTGGAGGCACTGAGAGCTTTGCTCGACATCGCCTTCACCGAGGGCAACCACCTCCAGGGCTCGTGGAGGGATGTT
TTGACATGTGTCAGTCAACTTGATCGGCTCCAACTCTTGAGTGATGGAGTCGATGAGGGGTCGCTGCCTGATGTT
TCAAGGGCACCTTCAGCACTTTCTAGGACGCCTTCATCAGCAGATACCTCCCGCAGATCTACGCAAAGTACACGA
CGCCCTCGCCCTCGCTCTGTGAATGGGCCAACCGCTTTCCGCCCAGAAATTGCCATGGAGAGCCGTTCGGCAGAT
ATGATTCGTGGCGTGGACCGTATCTTTACCAACACTGCTAATCTGTCGCATGAGGCAATTATTGACTTCGTTCGG
GCCTTGAGCGAGGTCAGCTGGCAAGAAATCCAATCTTCCGGTCACACCGATTCGCCCCGAACCTACAGTCTGCAG
AAGCTCGTCGAGATCAGCTACTACAACATGACTCGGGTCAGGATTGAGTGGTCTAAGATTTGGGATGTTTTGGGC
CAGCACTTTAATCAAGTTGGCTGCCACTCTAATACCATGGTTGTCTTCTTTGCCTTGGATTCGCTCCGGCAACTT
TCGATGCGCTTCTTGGAGATTGAGGAGTTGCCTGGTTTCAAGTTCCAAAAGGACTTCCTTAAGCCTTTTGAGCAT
GTGATGGCAAACAGCACCACTGCTGCTGTTAAGGATATGATTCTGCGGTGTCTGATCCAGATGATCCAGGCCCGT
GGCGACAATATTCGTTCGGGATGGAAGACTATGTTTGGTGTCTTTACGGTCGCAGCACGGGAACCCTATGAGGGA
ATCGTGAACATGGCTTTTGACCATGTCACCCAAGTATACAATACCAGATTTGGCGTAGTAATCACCCAAGGTGCC
TTTGCAGATCTCATCGTATGCCTGACTGAATTCTCAAAGAACTCCAAGTTCCAAAAGAAATCACTGCAGGCAATT
GAGACCCTCAGGTCTACCGTCACCAAAATGCTACGGACTCCAGAATGTCCCTTGTCACACCGTGGTGCTTCGGCG
GCCATCTTCCAGGACAATGGAACCAATCTTGCTAAACAACTTACCCGTCAATCACAAGAGGAGCAGTTCTGGTAT
CCGATTCTCATCGCATTCCAGGATGTACTCATGACGGGGGATGATCTCGAGGTCCGCTCACGGGCACTCACATAC
CTCTTTGATACGCTAATCCGTCATGGTGGCGATTTCCCCAGGGACTTTTGGGATGTCCTTTGGAGACAGCTCCTC
TACCCGATCTTTGTTGTCCTGCAGTCTAAGTCCGAAATGTCCAAGGTTCCGAACCACGAGGATCTTTCAGTCTGG
CTGTCCACGACAATGATCCAGGCGCTACGGAACATGATCACTTTGTTCACGCACTATTTCGATGCACTGGAGTAC
ATGCTGAGCCGCTTCTTGGAACTGCTGATATTATGCATTTGTCAAGAAAATGACACGATTGCACGAATTGGCAGC
AATTGCCTGCAACAGCTGATTTTGCAGAATGTTGCAAAGTTCAAGCCGGAGCACTGGTCCCAGATTGTTGGGGCA
TTCGTGGAGCTTTTCAGCAAAACGACCGCCTACGAACTTTTCACGGCTGCTGCATCGATATCTAAGCCGACAGAG
GCAGTTAATGGGGACCTCACCCAATCTCCAGATGCTGCTGTAGCAACAAAAGAGATGCCTGATGCATTGCAGCCT
AACGGATCCCAAAGCGCATCTTCTCTCCATGATCCTCCTGTCCAAAGTGAAGCCCGCGCCGAATTGGAAGACTAT
CGCCCTCACTCAGACCAGCAGCAACCTGCGGCTGTCACTGCAGCTCGGCGCCGTTACTTCAACCGCATCATCACG
AACTGCGTTCTCCAGCTGCTCATGATTGAAACGGTCCACGAACTTTTCTCGAACGAAAATGTCTATGCACAGATT
CCCAGTGGAGAGCTCCTGCGGCTCATGGGGCTGCTGAAAAAGAGTTATCAGTTCGCGAAGAAGTTCAACGAGGAT
AAGGACTTGCGAATGCAACTCTGGCGCCAGGGATTCATGAAGCAACCTCCTAATCTATTGAAGCAGGAGAGCGGT
AGTGCCTCTACCTACGTGCATATCCTCTTCCGAATGTATCACGACGAGCGAGAGGAAAGACAGAGCAGTCGCGCA
GAGACCGAGGCTGCACTCATTCCACTCTGCGCGGATATTATTCGCAGTTTCGTTCGCCTTGAAGAGGACACCCAG
CACCGCAACATCGTCGCTTGGCGTCCGGTTGTGGTCGATGTCATTGATGGATATACTAACTTCCCGCAAGATGAC
TTTAATAAGCATATTGAGGCCTTTTACCCTCTCGGAGTTGAGCTTCTGAGCCGTGATCTCAATCCGGAGATTCGC
GTTGCCCTCCAGTCTCTACTGCGCCGGACCGGCGAGGTCCGACTAGGCATTGCTCCGCCCAATCCCCTAGACGTC
CCCATCAGCCCGCGCAGCTCCGTCTCCCAGAAAGCCTCGCGCCGCGATAGCCAGGTCTGA
Gene >Pro_DTO377G3_2|g1693.t1
ATGGCGGACACCGAAGTCGGCTCAGAGCCGACCCAATCCATTGCAATGCCTGAGAAATCCGTCGAGACCCCCGAC
ACATCTTCTACAGTACCAAACTCCGACGAGCCAACACTGCCCGAGCAGACCGAATCGGAAGAACCAAACCAGGAG
AGCGACGAGGGAGTAGCCGAGGTCCAGGAAGATGAAGAAAAATCAGAGGTCCCGTCTAAGCACGAGCCTGAACAA
ACTGAACAAGAACCGCAAACAGACGGTCCGCCTACGATCCAGGAACCCCCCCACGAGGACAACACTGCGACAGAA
AGCAGATGGCGATCGGATTCGCGGTCAACAACGGCTACGTTTATGACGCAGCGATCTAGCCCAGTCAGCTCGACG
GTCTTTATTGTGACGGCTCTGGACAATATCGCTGCTTCGCGGGACGCCCGGAGGGACAAAAAGCTGGAGGATGCC
ACACAGGTGGCCCTGGCCAATATCAGACAACCTGATGGGCAAGCCATTGATCCGGAGCTTATCTTCCGTCCTCTA
CACCTGGCAAGCAAAGCCCTGAGCATTCCTCTACAAGTGACTGCATTGGACTGCATTGGAAAGCTGATCACATAC
TCCTATTTCGCGTTTCCATCTGCCGCGACAGACAACAATGCCACGCGCGAACAACCTCCTCTTATTGAGCGTGCT
ATTGATGCGATCTGCGAATGCTTCGAGAATGAAGCAACGGCCGTTGAGATCCAACAGCAGATCATCAAATCGCTA
TTGGCAGCGGTCTTGAACGACAAGATCGTGGTGCATGGAGCTGGTCTCCTGAAAGCCGTCCGCCAAATCTATAAC
ATCTTTATCTACTCCAAATCCAGTCAAAACCAGCAGATCGCTCAGGGGTCGCTCACACAAATGGTCAGCACGGTC
TTTGATCGCGTGCGGACACGGATGGATCTTAAAGAGCTCCGAGTGCGAGAGCTAGAAAATCCATCCTCGACCCTT
GATACATCGGCGAGTGACGTGGGCCAAAACTCGGAGACGGCTGATCAGCCCGTCATTAAAGAGCCCACTGCTGAG
AAGCTCACCCTACAGAGTTTTGAGTCGCCTAACGAGGTTACCACTGTCAACGATAATGCGCCGACTACAGTCACG
CGTGCTAAGCGGTCAACGACGAGGTCAATGTCGGGTATCCCCGAGGAAAAAGATGATGATAGCTCGGCCGAGGAC
GATGTGGACGAGATTTACGTCAAGGATGCTTTTTTGGTCTTCCGAGCGCTCTGCAAATTGAGCCACAAGGTTCTG
ACTCACGAGCAGCAACAAGATGTCAAATCCCAGAACATGAGGTCGAAGCTACTTTCACTGCACTTGATTCACTAC
CTCATCAACAACCACACCGCAACCTTTCTATCCCCTCTGGCAGCAATCAAGAACAGCTCATCCAGCGTGGATGGA
ATGAATCTCCTGCTAGCTGTACGACCTCATTTGTGTCTAAGTTTAAGTCGCAATGGTTCTAGCGCTGTGCCTCAT
GTCTTCAAAGTCTGTTGTGAAATCTTCTGGCTGATGTTGAAGGACATGAGAGTCATGATGAAAAAGGAACTCGAG
GTGTTCTTGAAAGAAATTTATCTCGCCATTCTCGAGAAGCGCGGGGCTCCTACGTTCCAAAAGCAGTACTTCATG
GAGATTCTGGAGAGGCTAGGTGGTGATCCACGGGCTCTGGTTGAAATCTATCTCAACTACGACTGTGACAGAACC
GCTTTGGAGAATATATTCCAAAAGTATGCTCTACTCAATTCTTGATTTTCTTTGGCATGGACTAACCTTCTTAGT
ATCATTGAGCAATTGTCCCGGTACTCAAGCGTGCCGGTTGTAACAACACCTTCACAGCAGCATCAGTACCAAGAA
CAACACACTAAAATGTCAGCCATTGGTTCTGAATGGCACCATCGAGGAAATCTTCCTCCTTCCTTGACAAGTGCA
CACATTGCCCCTACTCCGCCGTCCTCGATGCCTCATATTCCACCGGAGTACGGATTGAAACAGCAGGGTTTGGAG
TGTCTTGTGGAGATACTGCGCTCACTGGACAACTGGGCCACACATCGCATCGATGAACTGCCCGAGGCGGCCATT
CCCTCTAAATCGATAGATAACTCCCGTGAGTCCTTGGACACAAGCGTGCTTGTTTCACCGCATCTGGAGTCCTTC
GAGAGTGGGACTGGCCGGTCCACACCTATGCCCGAAGACGACCCAAACCAGATTGAAAAAGTCAAGCAACGAAAA
ATCGCTCTCACAAATGCCGTCCAACAATTTAATTTCAAGCCCAAGCGTGGCATCAAGGCCTTCCTGAAAGAAGGT
TTCATCAAATCCGAGTCTCCCGAAGAAATTGCCAGCTTCCTACTTCGCACAGACCGTATTGACAAGGCCATGCTG
GGAGAGTATCTTGGTGAGGGAGACCAGCAAAACATTGCTATCATGCATGCTTTTGTTGATTTGATGGAATTCACG
AAGCGACGCTTCGTTGAATCCCTGCGCTCGTTTTTGCAGCATTTCCGCCTCCCTGGTGAAGCCCAAAAGATCGAT
CGGTTTATGCTGAAGTTTGCCGAACGGTATACAACTCAAAACCCCAATGCCTTCGCTAACGCTGACACTGCATAT
GTGCTTGCGTACTCGGTGATTCTCCTCAACACAGATCAACACAGTTCGAAAATGAAGGGCCGCCGTATGACCAAG
GAGGACTTTATCAAGAACAACCGCGGGATCAATGACAACCAGGATCTACCGGCCGAATATCTTGGGACCATTTAT
GAGGAGATTGGAAGTAATGAAATCGTGCTATACACCGAGCAGGAACATGCCGCCAACTTCAACCCTCCACCCCCG
GCTCCCACTGGCCTTGCAACCAGGGCTGGACAGGTGTTTGCGACTGTTGGACGAGACATCCAGGGTGAGAAATAC
GCACAGGCTTCTGAGGAAATGGCGAACAAGACAGAACAGCTCTATCGTTCCCTTATTCGAGCCCAGCGCAAGACA
GCAGTTAAAGATGCGCTTTCGCACTTCATTCCCGCGACATCAGATCGTCATGTCGGGTCAATGTTCAACGTCACA
TGGATGTCTTTCCTATCTGGTCTGTCTGCACCGATGCAAGACACGTCCAACCTGGAAACCATCCGGCTCTGCATG
GAGGGACTTAAACTGTCCATCCGGATTAGCTGTGCCTTCGACCTAGAGACTCCTCGCGTGGCCTTTGTGACTGCC
TTGGCGAAGTTCACTAACCTCGGAAACGTGAGGGAGATGATGGCCAAAAATGTGGAGGCACTGAGAGCTTTGCTC
GACATCGCCTTCACCGAGGGCAACCACCTCCAGGGCTCGTGGAGGGATGTTTTGACATGTGTCAGTCAACTTGAT
CGGCTCCAACTCTTGAGTGATGGAGTCGATGAGGGGTCGCTGCCTGATGTTTCAAGGGCACCTTCAGCACTTTCT
AGGACGCCTTCATCAGCAGATACCTCCCGCAGATCTACGCAAAGTACACGACGCCCTCGCCCTCGCTCTGTGAAT
GGGCCAACCGCTTTCCGCCCAGAAATTGCCATGGAGAGCCGTTCGGCAGATATGATTCGTGGCGTGGACCGTATC
TTTACCAACACTGCTAATCTGTCGCATGAGGCAATTATTGACTTCGTTCGGGCCTTGAGCGAGGTCAGCTGGCAA
GAAATCCAATCTTCCGGTCACACCGATTCGCCCCGAACCTACAGTCTGCAGAAGCTCGTCGAGATCAGCTACTAC
AACATGACTCGGGTCAGGATTGAGTGGTCTAAGATTTGGGATGTTTTGGGCCAGCACTTTAATCAAGTTGGCTGC
CACTCTAATACCATGGTTGTCTTCTTTGCCTTGGATTCGCTCCGGCAACTTTCGATGCGCTTCTTGGAGATTGAG
GAGTTGCCTGGTTTCAAGTTCCAAAAGGACTTCCTTAAGCCTTTTGAGCATGTGATGGCAAACAGCACCACTGCT
GCTGTTAAGGATATGATTCTGCGGTGTCTGATCCAGATGATCCAGGCCCGTGGCGACAATATTCGTTCGGGATGG
AAGACTATGTTTGGTGTCTTTACGGTCGCAGCACGGGAACCCTATGGTAAGCCTCGCTGCTCAAATTAATCCGTC
CCTCGCTAATGTATCAAACAGAGGGAATCGTGAACATGGCTTTTGACCATGTCACCCAAGTATACAATACCAGAT
TTGGCGTAGTAATCACCCAAGGTGCCTTTGCAGATCTCATCGTATGCCTGACTGAATTCTCAAAGAACTCCAAGT
TCCAAAAGAAATCACTGCAGGCAATTGAGACCCTCAGGTCTACCGTCACCAAAATGCTACGGACTCCAGAATGTC
CCTTGTCACACCGTGGTGCTTCGGCGGCCATCTTCCAGGACAATGGAACCAATCTTGCTAAACAACTTACCCGTC
AATCACAAGAGGAGCAGTTCTGGTATCCGATTCTCATCGCATTCCAGGATGTACTCATGACGGGGGATGATCTCG
AGGTCCGCTCACGGGCACTCACATACCTCTTTGATACGCTAATCCGTCATGGTGGCGATTTCCCCAGGGACTTTT
GGGATGTCCTTTGGAGACAGCTCCTCTACCCGATCTTTGTTGTCCTGCAGTCTAAGTCCGAAATGTCCAAGGTTC
CGAACCACGAGGATCTTTCAGTCTGGCTGTCCACGACAATGATCCAGGCGCTACGGAACATGATCACTTTGTTCA
CGCACTATTTCGATGCACTGGAGTACATGCTGAGCCGCTTCTTGGAACTGCTGATATTATGCATTTGTCAAGAAA
ATGACACGATTGCACGAATTGGCAGCAATTGCCTGCAACAGCTGATTTTGCAGAATGTTGCAAAGTTCAAGCCGG
AGCACTGGTCCCAGATTGTTGGGGCATTCGTGGAGCTTTTCAGCAAAACGACCGCCTACGAACTTTTCACGGCTG
CTGCATCGATATCTAAGCCGACAGAGGCAGTTAATGGGGACCTCACCCAATCTCCAGATGCTGCTGTAGCAACAA
AAGAGATGCCTGATGCATTGCAGCCTAACGGATCCCAAAGCGCATCTTCTCTCCATGATCCTCCTGTCCAAAGTG
AAGCCCGCGCCGAATTGGAAGACTATCGCCCTCACTCAGACCAGCAGCAACCTGCGGCTGTCACTGCAGCTCGGC
GCCGTTACTTCAACCGCATCATCACGAACTGCGTTCTCCAGCTGCTCATGATTGAAACGGTCCACGAACTTTTCT
CGAACGAAAATGTCTATGCACAGATTCCCAGTGGAGAGCTCCTGCGGCTCATGGGGCTGCTGAAAAAGAGTTATC
AGTTCGCGAAGAAGTTCAACGAGGATAAGGACTTGCGAATGCAACTCTGGCGCCAGGGATTCATGAAGCAACCTC
CTAATCTATTGAAGCAGGAGAGCGGTAGTGCCTCTACCTACGTGCATATCCTCTTCCGAATGTATCACGACGAGC
GAGAGGAAAGACAGAGCAGTCGCGCAGAGACCGAGGCTGCACTCATTCCGTAAGTTCATTATCTAATATTCTCTC
CTTGTTCATTGCTAATTTCACTAGACTCTGCGCGGATATTATTCGCAGTTTCGTTCGCCTTGAAGAGGACACCCA
GCACCGCAACATCGTCGCTTGGCGTCCGGTTGTGGTCGATGTCATTGATGGATATACTAACTTCCCGCAAGATGA
CTTTAATAAGCATATTGAGGCCTTTTACCCTCTCGGAGTTGAGCTTCTGAGCCGTGATCTCAATCCGGAGATTCG
CGTTGCCCTCCAGTCTCTACTGCGCCGGACCGGCGAGGTCCGACTAGGCATTGCTCCGCCCAATCCCCTAGACGT
CCCCATCAGCCCGCGCAGCTCCGTCTCCCAGAAAGCCTCGCGCCGCGATAGCCAGGTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail