Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g1689.t1
Gene name
Locationscaffold_02:598487..599672
Strand-
Gene length (bp)1185
Transcript length (bp)1023
Coding sequence length (bp)1023
Protein length (aa) 341

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain 1.0E-44 170 336
PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain 3.8E-43 25 168

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor Yes
GO:0016614 oxidoreductase activity, acting on CH-OH group of donors No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 32 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 1417.68 764.56 2070.79
5d_25C Five days - 25 degrees Celsius 834.40 468.05 1200.74
7d_25C Seven days - 25 degrees Celsius 565.85 327.42 804.28
10d_25C Ten days - 25 degrees Celsius 450.87 262.69 639.06
7d_15C Seven days - 15 degrees Celsius 1158.01 635.94 1680.08
7d_30C Seven days - 30 degrees Celsius 487.75 287.80 687.70

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.027948 yes
3d_25C 7d_25C 0.000700 yes
3d_25C 7d_15C 0.497202 no
3d_25C 7d_30C 0.000700 yes
3d_25C 10d_25C 0.000700 yes
5d_25C 7d_25C 0.109902 no
5d_25C 7d_15C 0.200076 no
5d_25C 7d_30C 0.015268 yes
5d_25C 10d_25C 0.005626 yes
7d_25C 7d_15C 0.000700 yes
7d_25C 7d_30C 0.602111 no
7d_25C 10d_25C 0.377267 no
7d_15C 7d_30C 0.000700 yes
7d_15C 10d_25C 0.000700 yes
7d_30C 10d_25C 0.806131 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g1689.t1
MFAARRTVNLFQKRAFSASAFNASKVAVLGAAGGIGQPLSLLLKLNPRVSQLALYDIRGAPGVAADLSHINTNST
VTGYKPEGTGLKDCLEGSEIILIPAGVPRKPGMTRDDLFNTNASIVRDLAKAAAEAAPKALVLVIANPVNSTVPI
VAEVYKARNVYDPKRLFGITTLDVVRSSRFISQVEKTNPANEAVTVVGGHSGVTIVPLLSQSSHPSISGEVRDAL
VKRIQFGGDEVVQAKDGAGSATLSMAMAGARFAESLLRAAQGEKGVIEPTFVDSPLYKDQGVDFFASRVELGPNG
VEQILPVGKVNEYEQGLLDASLVDLKKNIKKGVDFVKANP*
Coding >Pro_DTO377G3_2|g1689.t1
ATGTTTGCTGCTCGTCGTACTGTCAACCTCTTCCAGAAGCGTGCCTTCTCGGCCTCCGCTTTCAATGCCTCCAAG
GTCGCCGTTCTCGGCGCTGCCGGTGGTATTGGCCAGCCTCTCTCGCTGCTGCTGAAGCTCAACCCCCGTGTTTCC
CAGCTCGCTCTCTACGATATCCGCGGTGCTCCCGGTGTCGCTGCTGATTTGAGCCACATCAACACCAACAGCACT
GTTACCGGCTACAAGCCCGAGGGTACCGGTCTCAAGGACTGCCTCGAGGGATCCGAGATCATCCTCATCCCCGCT
GGTGTTCCCCGCAAGCCCGGCATGACCCGTGATGATCTCTTCAACACCAACGCCTCCATTGTCCGCGACCTCGCC
AAGGCCGCCGCTGAGGCCGCCCCCAAGGCCCTGGTCCTTGTCATCGCCAACCCCGTCAACTCCACCGTCCCCATC
GTTGCCGAGGTCTACAAGGCCCGCAACGTCTACGACCCCAAGCGTCTGTTCGGTATCACCACCCTTGATGTCGTC
CGTTCTTCGCGCTTCATCTCCCAGGTTGAGAAGACCAACCCCGCCAATGAGGCCGTCACCGTCGTTGGTGGCCAC
TCCGGTGTGACCATCGTCCCCCTGCTTTCGCAGTCTAGCCACCCCTCCATCTCCGGCGAGGTCCGCGACGCCCTT
GTCAAGCGCATCCAGTTCGGTGGTGACGAGGTTGTCCAGGCTAAGGACGGTGCCGGTTCCGCCACCCTCTCCATG
GCCATGGCCGGTGCCCGCTTCGCCGAGTCTCTCCTCCGCGCCGCTCAGGGCGAGAAGGGTGTCATCGAGCCCACC
TTCGTCGACTCCCCTCTGTACAAGGACCAGGGTGTTGACTTCTTCGCTTCCCGCGTTGAGCTCGGCCCCAACGGT
GTTGAGCAGATCCTCCCCGTTGGCAAGGTCAACGAGTACGAGCAGGGTCTCCTCGATGCCTCCCTGGTTGACTTG
AAGAAGAACATCAAGAAGGGTGTTGACTTCGTCAAGGCTAACCCTTGA
Transcript >Pro_DTO377G3_2|g1689.t1
ATGTTTGCTGCTCGTCGTACTGTCAACCTCTTCCAGAAGCGTGCCTTCTCGGCCTCCGCTTTCAATGCCTCCAAG
GTCGCCGTTCTCGGCGCTGCCGGTGGTATTGGCCAGCCTCTCTCGCTGCTGCTGAAGCTCAACCCCCGTGTTTCC
CAGCTCGCTCTCTACGATATCCGCGGTGCTCCCGGTGTCGCTGCTGATTTGAGCCACATCAACACCAACAGCACT
GTTACCGGCTACAAGCCCGAGGGTACCGGTCTCAAGGACTGCCTCGAGGGATCCGAGATCATCCTCATCCCCGCT
GGTGTTCCCCGCAAGCCCGGCATGACCCGTGATGATCTCTTCAACACCAACGCCTCCATTGTCCGCGACCTCGCC
AAGGCCGCCGCTGAGGCCGCCCCCAAGGCCCTGGTCCTTGTCATCGCCAACCCCGTCAACTCCACCGTCCCCATC
GTTGCCGAGGTCTACAAGGCCCGCAACGTCTACGACCCCAAGCGTCTGTTCGGTATCACCACCCTTGATGTCGTC
CGTTCTTCGCGCTTCATCTCCCAGGTTGAGAAGACCAACCCCGCCAATGAGGCCGTCACCGTCGTTGGTGGCCAC
TCCGGTGTGACCATCGTCCCCCTGCTTTCGCAGTCTAGCCACCCCTCCATCTCCGGCGAGGTCCGCGACGCCCTT
GTCAAGCGCATCCAGTTCGGTGGTGACGAGGTTGTCCAGGCTAAGGACGGTGCCGGTTCCGCCACCCTCTCCATG
GCCATGGCCGGTGCCCGCTTCGCCGAGTCTCTCCTCCGCGCCGCTCAGGGCGAGAAGGGTGTCATCGAGCCCACC
TTCGTCGACTCCCCTCTGTACAAGGACCAGGGTGTTGACTTCTTCGCTTCCCGCGTTGAGCTCGGCCCCAACGGT
GTTGAGCAGATCCTCCCCGTTGGCAAGGTCAACGAGTACGAGCAGGGTCTCCTCGATGCCTCCCTGGTTGACTTG
AAGAAGAACATCAAGAAGGGTGTTGACTTCGTCAAGGCTAACCCTTGA
Gene >Pro_DTO377G3_2|g1689.t1
ATGTTTGCTGCTCGTCGTACTGTCAACCTCTTCCAGAAGCGTGCCTTCTCGGCCTCCGCTTTCAATGTGCGTTTC
TATTCATCTGTCTTCCCCAGAATTAAACCTAACTCTTCGCGCAGGCCTCCAAGGTCGCCGTTCTCGGCGCTGCCG
GTGGTATTGGCCAGCCTCTCTCGCTGCTGCTGAAGCTCAACCCCCGTGTTTCCCAGCTCGCTCTCTACGATATCC
GCGGTGCTCCCGGTATGAATGATCCAATTCGTTCAGCAAAAGCAATTACTGACTTTATTTAGGTGTCGCTGCTGA
TTTGAGCCACATCAACACCAACAGCACTGTTACCGGCTACAAGCCCGAGGGTACCGGTCTCAAGGACTGCCTCGA
GGGATCCGAGATCATCCTCATCCCCGCTGGTGTTCCCCGCAAGCCCGGCATGACCCGTGATGATCTCTTCAACAC
CAACGCCTCCATTGTCCGCGACCTCGCCAAGGCCGCCGCTGAGGCCGCCCCCAAGGCCCTGGTCCTTGTCATCGC
CAACCCCGTAAGTCGCAATTATCGCTCCACAATTCGAGGCCCCACTAACCACGCGTCATTAAAAAGGTCAACTCC
ACCGTCCCCATCGTTGCCGAGGTCTACAAGGCCCGCAACGTCTACGACCCCAAGCGTCTGTTCGGTATCACCACC
CTTGATGTCGTCCGTTCTTCGCGCTTCATCTCCCAGGTTGAGAAGACCAACCCCGCCAATGAGGCCGTCACCGTC
GTTGGTGGCCACTCCGGTGTGACCATCGTCCCCCTGCTTTCGCAGTCTAGCCACCCCTCCATCTCCGGCGAGGTC
CGCGACGCCCTTGTCAAGCGCATCCAGTTCGGTGGTGACGAGGTTGTCCAGGCTAAGGACGGTGCCGGTTCCGCC
ACCCTCTCCATGGCCATGGCCGGTGCCCGCTTCGCCGAGTCTCTCCTCCGCGCCGCTCAGGGCGAGAAGGGTGTC
ATCGAGCCCACCTTCGTCGACTCCCCTCTGTACAAGGACCAGGGTGTTGACTTCTTCGCTTCCCGCGTTGAGCTC
GGCCCCAACGGTGTTGAGCAGATCCTCCCCGTTGGCAAGGTCAACGAGTACGAGCAGGGTCTCCTCGATGCCTCC
CTGGTTGACTTGAAGAAGAACATCAAGAAGGGTGTTGACTTCGTCAAGGCTAACCCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail