Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g1672.t1
Gene name
Locationscaffold_02:563081..564140
Strand+
Gene length (bp)1059
Transcript length (bp)861
Coding sequence length (bp)861
Protein length (aa) 287

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 1.0E-12 83 153

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0097159 organic cyclic compound binding No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0003676 nucleic acid binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 50 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 9.54 3.03 16.05
5d_25C Five days - 25 degrees Celsius 4.53 0.93 8.14
7d_25C Seven days - 25 degrees Celsius 3.78 0.52 7.04
10d_25C Ten days - 25 degrees Celsius 2.43 0.12 4.74
7d_15C Seven days - 15 degrees Celsius 2.94 0.16 5.72
7d_30C Seven days - 30 degrees Celsius 3.87 0.71 7.03

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.077844 no
3d_25C 7d_25C 0.033043 yes
3d_25C 7d_15C 0.012904 yes
3d_25C 7d_30C 0.027043 yes
3d_25C 10d_25C 0.003625 yes
5d_25C 7d_25C 0.767247 no
5d_25C 7d_15C 0.442370 no
5d_25C 7d_30C 0.792140 no
5d_25C 10d_25C 0.228516 no
7d_25C 7d_15C 0.704106 no
7d_25C 7d_30C 0.976712 no
7d_25C 10d_25C 0.448839 no
7d_15C 7d_30C 0.662459 no
7d_15C 10d_25C 0.795887 no
7d_30C 10d_25C 0.405721 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g1672.t1
MNDIESPRLEEQQTPTKSPFANVRPDGRAFNSPNWRMKVASPTPSRTNASPSPSPNPNPNTSRAAFSRPGAHVPQ
AINDGRRLYVGNMPYTAKMEDVEALFIAAEFPIERIDIAIDPFTGRNPSYCFVDLQSKEHAERAMTELNGRDMLG
RPVKIKPGVAKSQERTQNPPEPFRIDRWRQQERPSFAKVNSDSSNRVYVGGLPRLTDHGAVQSNIELFFRGFKVE
NVSKVFAPHPAKRFDPGEHYYLFVDVGTPEQAQKAMDTLNGQQGPWGGPLRVQFARGPKDA*
Coding >Pro_DTO377G3_2|g1672.t1
ATGAATGATATCGAGAGCCCCAGACTGGAGGAGCAACAGACTCCTACCAAGTCTCCCTTTGCAAATGTCCGTCCC
GATGGTCGAGCCTTCAACTCTCCCAATTGGCGCATGAAGGTTGCAAGCCCAACACCATCGCGCACCAATGCTAGC
CCGAGCCCGAGCCCCAACCCTAACCCCAATACCTCCCGCGCAGCCTTCAGCCGGCCCGGAGCGCACGTCCCCCAA
GCGATTAACGATGGGCGCCGCCTATACGTCGGCAATATGCCATACACGGCCAAGATGGAGGATGTGGAGGCGCTG
TTCATAGCGGCCGAGTTCCCTATCGAGCGCATAGATATTGCCATTGATCCTTTTACCGGCCGGAACCCCTCCTAC
TGCTTTGTCGACCTACAGAGCAAGGAGCATGCCGAGCGCGCCATGACCGAGCTCAATGGCCGCGATATGCTGGGT
CGCCCTGTCAAGATCAAGCCCGGTGTCGCCAAGTCTCAGGAGCGCACTCAGAACCCGCCTGAGCCATTCCGCATT
GATCGTTGGCGCCAGCAAGAGAGACCTAGTTTTGCGAAGGTCAACAGTGACTCCAGCAACCGCGTGTACGTCGGT
GGTCTGCCGCGCTTGACCGACCACGGGGCTGTGCAGAGCAACATCGAGCTTTTCTTCCGAGGATTCAAGGTTGAG
AATGTCAGCAAGGTCTTCGCTCCCCACCCCGCTAAGCGGTTCGATCCGGGCGAGCACTACTATCTGTTCGTTGAT
GTGGGTACTCCCGAGCAAGCCCAGAAAGCTATGGATACACTGAATGGTCAGCAAGGACCATGGGGTGGTCCGCTG
CGCGTCCAGTTCGCTCGTGGTCCCAAGGATGCCTGA
Transcript >Pro_DTO377G3_2|g1672.t1
ATGAATGATATCGAGAGCCCCAGACTGGAGGAGCAACAGACTCCTACCAAGTCTCCCTTTGCAAATGTCCGTCCC
GATGGTCGAGCCTTCAACTCTCCCAATTGGCGCATGAAGGTTGCAAGCCCAACACCATCGCGCACCAATGCTAGC
CCGAGCCCGAGCCCCAACCCTAACCCCAATACCTCCCGCGCAGCCTTCAGCCGGCCCGGAGCGCACGTCCCCCAA
GCGATTAACGATGGGCGCCGCCTATACGTCGGCAATATGCCATACACGGCCAAGATGGAGGATGTGGAGGCGCTG
TTCATAGCGGCCGAGTTCCCTATCGAGCGCATAGATATTGCCATTGATCCTTTTACCGGCCGGAACCCCTCCTAC
TGCTTTGTCGACCTACAGAGCAAGGAGCATGCCGAGCGCGCCATGACCGAGCTCAATGGCCGCGATATGCTGGGT
CGCCCTGTCAAGATCAAGCCCGGTGTCGCCAAGTCTCAGGAGCGCACTCAGAACCCGCCTGAGCCATTCCGCATT
GATCGTTGGCGCCAGCAAGAGAGACCTAGTTTTGCGAAGGTCAACAGTGACTCCAGCAACCGCGTGTACGTCGGT
GGTCTGCCGCGCTTGACCGACCACGGGGCTGTGCAGAGCAACATCGAGCTTTTCTTCCGAGGATTCAAGGTTGAG
AATGTCAGCAAGGTCTTCGCTCCCCACCCCGCTAAGCGGTTCGATCCGGGCGAGCACTACTATCTGTTCGTTGAT
GTGGGTACTCCCGAGCAAGCCCAGAAAGCTATGGATACACTGAATGGTCAGCAAGGACCATGGGGTGGTCCGCTG
CGCGTCCAGTTCGCTCGTGGTCCCAAGGATGCCTGA
Gene >Pro_DTO377G3_2|g1672.t1
ATGAATGATATCGAGAGCCCCAGACTGGAGGAGCAACAGAGTAAGATCGTCCTCAGAAAATACCCCAAAAAGTCT
CGACTAATCGATATCTACATTATACAGCTCCTACCAAGTCTCCCTTTGCAAATGTCCGTCCCGATGGTCGAGCCT
TCAACTCTCCCAATTGGCGCATGAAGGTTGCAAGCCCAACACCATCGCGCACCAATGCTAGCCCGAGCCCGAGCC
CCAACCCTAACCCCAATACCTCCCGCGCAGCCTTCAGCCGGCCCGGAGCGCACGTCCCCCAAGCGATTAACGATG
GGCGCCGCCTATACGTCGGCAATATGCCATACACGGCCAAGATGGAGGATGTGGAGGCGCTGTTCATAGCGGCCG
AGTTCCCTATGTATGCCTGCACCACTTGAAACCTGCTGGCCCAGCCGTGAATCGTCGTCAACTGAACAACCCCCG
AAAATAGCGAGCGCATAGATATTGCCATTGATCCTTTTACCGGCCGGAACCCCTCCTACTGCTTTGTCGACCTAC
AGAGCAAGGAGCATGCCGAGCGCGCCATGACCGAGCTCAATGGCCGCGATATGCTGGGTCGCCCTGTCAAGATCA
AGCCCGGTGTCGCCAAGTCTCAGGAGCGCACTCAGAACCCGCCTGAGCCATTCCGCATTGATCGTTGGCGCCAGC
AAGAGAGACCTAGTTTTGCGAAGGTCAACAGTGACTCCAGCAACCGCGTGTACGTCGGTGGTCTGCCGCGCTTGA
CCGACCACGGGGCTGTGCAGAGCAACATCGAGCTTTTCTTCCGAGGATTCAAGGTGTAAGTTTGGATGGCTTGGG
TTTCTGCTATCGTGTGATCAGTACTGATGCGCTGTGGTTTGCAGTGAGAATGTCAGCAAGGTCTTCGCTCCCCAC
CCCGCTAAGCGGTTCGATCCGGGCGAGCACTACTATCTGTTCGTTGATGTGGGTACTCCCGAGCAAGCCCAGAAA
GCTATGGATACACTGAATGGTCAGCAAGGACCATGGGGTGGTCCGCTGCGCGTCCAGTTCGCTCGTGGTCCCAAG
GATGCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail