Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g167.t1
Gene name
Locationscaffold_01:436351..438806
Strand+
Gene length (bp)2455
Transcript length (bp)2289
Coding sequence length (bp)2289
Protein length (aa) 763

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16413 Mlh1_C DNA mismatch repair protein Mlh1 C-terminus 2.0E-96 484 762
PF01119 DNA_mis_repair DNA mismatch repair protein, C-terminal domain 3.2E-33 248 366
PF13589 HATPase_c_3 Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase 2.9E-13 55 153
PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase 1.3E-07 54 123

GO

GO Term Description Terminal node
GO:0006298 mismatch repair Yes
GO:0005524 ATP binding Yes
GO:0030983 mismatched DNA binding Yes
GO:0006950 response to stress No
GO:1901265 nucleoside phosphate binding No
GO:0046483 heterocycle metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0009987 cellular process No
GO:0043170 macromolecule metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0043168 anion binding No
GO:0044238 primary metabolic process No
GO:0032559 adenyl ribonucleotide binding No
GO:0090304 nucleic acid metabolic process No
GO:0033554 cellular response to stress No
GO:0044260 cellular macromolecule metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0006281 DNA repair No
GO:0032553 ribonucleotide binding No
GO:0071704 organic substance metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0032555 purine ribonucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0003674 molecular_function No
GO:0036094 small molecule binding No
GO:0044237 cellular metabolic process No
GO:0050896 response to stimulus No
GO:0005488 binding No
GO:0006259 DNA metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0003676 nucleic acid binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0043167 ion binding No
GO:0006807 nitrogen compound metabolic process No
GO:0006974 cellular response to DNA damage stimulus No
GO:0000166 nucleotide binding No
GO:0008144 drug binding No
GO:0051716 cellular response to stimulus No
GO:0003690 double-stranded DNA binding No
GO:0008150 biological_process No
GO:0003677 DNA binding No
GO:0008152 metabolic process No
GO:0030554 adenyl nucleotide binding No
GO:0097367 carbohydrate derivative binding No
GO:0017076 purine nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 39 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g167.t1
MEDDMNIEPIDQRGTKRAVEEDEPLEPPKPKKIKALDPDVVNKIAAGEIIVAPMHALKELIENAVDAGSTSIEVL
IKEGGLKLLQITDNGHGIDRDDLPILCERFTTSKLKEFEDLTSIGTYGFRGEALASISHIAHLTVTTKTAGSSCA
WRAHYGDGKLIPAKPGQNSAPKATAGRGGTQITVEDLFYNVPTRRRAFRSASEEYAKILDVVGRYAVHCSGVAFS
CRKHGDSGVSISTPVSANTVDRIRQIHGSAVANELVEFKTEDTKFGFHASGFATNANYHVKKTVILLFINHRAVE
STAVKRAVEQTYSAFLPKGGHPFVYLDLEVEPSRVDVNVHPTKREVNFLNEDEIIELVCAEIRSKLVEVDSSRTF
LTQSLLPGVQTIESLQRDRDAQTHEGTAEATKAGATPKTPATAKRPYENNLIRTDSKVRKITAMLGPAASPRDPS
NPDAPTEPNDPTTSILDNGLQYETTDRQPLKIALSSVKGLRAAVRSEMHNTLTEMFASHTYVGLVDERRRLAAIQ
SGVKLYLIDYGLACHEFFYQVGLTDFGNFGVIRLDPAPKLVDLLKIAAESERQEHPDSSKADEADSIFANAPEMI
ARTLIDRREMLNEYFSLQISPDGDLLSIPLLLKGYLPALAKLPRFLLRLGPYVDWDSEEGCFRTFLRELAAFYTP
EQLPVLSRPVAQDALGESVTQGPVVADDSGVEDEDAFVRARRAQMVRMLEYAIFPALRARLVATSRLLRGVVEVA
DLKGLYRVFERC*
Coding >Pro_DTO377G3_2|g167.t1
ATGGAAGACGATATGAATATTGAGCCTATCGATCAACGCGGCACCAAGCGCGCCGTAGAGGAAGATGAGCCTCTG
GAACCCCCTAAACCAAAGAAAATCAAGGCTTTGGATCCCGATGTCGTAAATAAAATTGCTGCTGGGGAGATTATC
GTTGCTCCAATGCACGCACTGAAGGAGCTCATCGAAAACGCCGTCGATGCTGGCTCCACCTCGATTGAAGTCCTA
ATTAAGGAAGGGGGTCTGAAACTACTCCAGATTACTGATAATGGCCATGGCATTGATCGAGACGATCTCCCTATT
CTCTGCGAGAGATTCACTACATCTAAGCTCAAAGAATTCGAAGATTTGACCTCCATTGGAACATACGGATTCCGC
GGTGAAGCTCTAGCTAGTATCAGTCATATCGCACATCTGACGGTTACAACGAAGACTGCTGGATCCAGCTGCGCC
TGGCGAGCACATTACGGAGATGGCAAATTGATACCGGCAAAGCCAGGCCAGAATTCCGCACCCAAGGCAACGGCT
GGCCGAGGGGGAACTCAAATTACCGTCGAGGATCTCTTCTATAACGTTCCCACTCGACGGAGAGCATTCCGCTCG
GCAAGCGAGGAATATGCTAAAATCCTTGATGTCGTTGGCCGGTACGCAGTGCATTGCTCCGGAGTTGCTTTCTCA
TGCCGCAAGCACGGAGACTCCGGTGTGAGCATATCAACTCCAGTCAGCGCAAATACTGTCGACCGGATCCGCCAG
ATCCACGGCAGTGCCGTGGCAAACGAACTTGTTGAATTCAAAACAGAGGATACCAAGTTCGGATTTCACGCATCC
GGCTTCGCTACCAACGCCAACTATCATGTCAAGAAGACAGTAATTCTGCTTTTCATAAATCACCGCGCAGTAGAG
TCAACCGCTGTTAAGCGTGCAGTTGAACAGACTTACTCTGCCTTTTTGCCCAAAGGCGGCCATCCTTTCGTCTAT
CTTGATCTCGAGGTCGAGCCTAGCCGCGTCGACGTGAATGTACACCCGACAAAGCGGGAAGTAAATTTCCTAAAT
GAAGACGAGATCATTGAACTTGTTTGCGCTGAAATCCGATCCAAGCTGGTTGAGGTAGATTCGAGTCGCACGTTC
CTGACACAAAGTCTCCTACCTGGCGTGCAGACAATCGAGTCACTACAACGCGATCGAGACGCTCAAACTCACGAG
GGAACAGCAGAGGCAACAAAAGCCGGAGCGACGCCCAAAACGCCCGCAACGGCTAAGAGACCCTACGAAAACAAC
CTCATAAGAACAGACTCAAAAGTCCGCAAAATCACGGCAATGCTAGGCCCAGCCGCCTCACCTCGCGACCCATCC
AACCCAGACGCACCCACAGAACCCAACGACCCAACGACATCAATTCTAGACAACGGCCTCCAATACGAAACAACC
GATCGCCAACCCCTAAAGATCGCCCTCTCATCCGTCAAGGGTCTCCGAGCCGCCGTCCGCTCCGAGATGCACAAC
ACACTAACCGAGATGTTCGCGTCACACACATACGTCGGACTAGTGGACGAACGACGCCGACTCGCAGCAATCCAA
TCAGGCGTGAAGCTATACCTAATCGACTACGGACTCGCATGCCACGAATTCTTCTACCAAGTAGGCCTAACCGAC
TTCGGCAACTTCGGCGTAATCCGCCTAGACCCAGCGCCGAAGTTGGTAGATCTACTGAAAATCGCCGCAGAATCA
GAACGCCAAGAGCACCCGGACAGCAGCAAAGCGGACGAGGCCGATTCCATCTTCGCCAATGCACCGGAGATGATA
GCGCGCACGCTCATCGACCGTCGCGAAATGCTGAACGAGTACTTCTCGCTGCAGATCAGTCCCGACGGAGACTTG
CTTTCCATCCCGCTGTTGCTGAAGGGGTATCTGCCTGCGCTGGCGAAACTGCCTCGTTTCCTGCTGAGGCTTGGG
CCGTATGTGGACTGGGACAGTGAGGAGGGTTGTTTCCGTACATTTTTGCGTGAGCTGGCTGCTTTTTACACGCCT
GAGCAGCTTCCGGTTCTGTCGCGGCCTGTTGCGCAGGACGCGCTGGGGGAGTCGGTTACGCAGGGGCCGGTGGTA
GCCGATGACTCTGGGGTCGAGGATGAAGATGCTTTTGTTAGGGCGCGTCGTGCACAGATGGTTCGCATGTTGGAG
TATGCTATTTTCCCGGCTCTCCGTGCGCGGCTGGTTGCCACGTCACGGCTGCTGCGGGGTGTGGTTGAGGTTGCA
GATCTAAAGGGGCTATATCGGGTGTTTGAGCGCTGTTGA
Transcript >Pro_DTO377G3_2|g167.t1
ATGGAAGACGATATGAATATTGAGCCTATCGATCAACGCGGCACCAAGCGCGCCGTAGAGGAAGATGAGCCTCTG
GAACCCCCTAAACCAAAGAAAATCAAGGCTTTGGATCCCGATGTCGTAAATAAAATTGCTGCTGGGGAGATTATC
GTTGCTCCAATGCACGCACTGAAGGAGCTCATCGAAAACGCCGTCGATGCTGGCTCCACCTCGATTGAAGTCCTA
ATTAAGGAAGGGGGTCTGAAACTACTCCAGATTACTGATAATGGCCATGGCATTGATCGAGACGATCTCCCTATT
CTCTGCGAGAGATTCACTACATCTAAGCTCAAAGAATTCGAAGATTTGACCTCCATTGGAACATACGGATTCCGC
GGTGAAGCTCTAGCTAGTATCAGTCATATCGCACATCTGACGGTTACAACGAAGACTGCTGGATCCAGCTGCGCC
TGGCGAGCACATTACGGAGATGGCAAATTGATACCGGCAAAGCCAGGCCAGAATTCCGCACCCAAGGCAACGGCT
GGCCGAGGGGGAACTCAAATTACCGTCGAGGATCTCTTCTATAACGTTCCCACTCGACGGAGAGCATTCCGCTCG
GCAAGCGAGGAATATGCTAAAATCCTTGATGTCGTTGGCCGGTACGCAGTGCATTGCTCCGGAGTTGCTTTCTCA
TGCCGCAAGCACGGAGACTCCGGTGTGAGCATATCAACTCCAGTCAGCGCAAATACTGTCGACCGGATCCGCCAG
ATCCACGGCAGTGCCGTGGCAAACGAACTTGTTGAATTCAAAACAGAGGATACCAAGTTCGGATTTCACGCATCC
GGCTTCGCTACCAACGCCAACTATCATGTCAAGAAGACAGTAATTCTGCTTTTCATAAATCACCGCGCAGTAGAG
TCAACCGCTGTTAAGCGTGCAGTTGAACAGACTTACTCTGCCTTTTTGCCCAAAGGCGGCCATCCTTTCGTCTAT
CTTGATCTCGAGGTCGAGCCTAGCCGCGTCGACGTGAATGTACACCCGACAAAGCGGGAAGTAAATTTCCTAAAT
GAAGACGAGATCATTGAACTTGTTTGCGCTGAAATCCGATCCAAGCTGGTTGAGGTAGATTCGAGTCGCACGTTC
CTGACACAAAGTCTCCTACCTGGCGTGCAGACAATCGAGTCACTACAACGCGATCGAGACGCTCAAACTCACGAG
GGAACAGCAGAGGCAACAAAAGCCGGAGCGACGCCCAAAACGCCCGCAACGGCTAAGAGACCCTACGAAAACAAC
CTCATAAGAACAGACTCAAAAGTCCGCAAAATCACGGCAATGCTAGGCCCAGCCGCCTCACCTCGCGACCCATCC
AACCCAGACGCACCCACAGAACCCAACGACCCAACGACATCAATTCTAGACAACGGCCTCCAATACGAAACAACC
GATCGCCAACCCCTAAAGATCGCCCTCTCATCCGTCAAGGGTCTCCGAGCCGCCGTCCGCTCCGAGATGCACAAC
ACACTAACCGAGATGTTCGCGTCACACACATACGTCGGACTAGTGGACGAACGACGCCGACTCGCAGCAATCCAA
TCAGGCGTGAAGCTATACCTAATCGACTACGGACTCGCATGCCACGAATTCTTCTACCAAGTAGGCCTAACCGAC
TTCGGCAACTTCGGCGTAATCCGCCTAGACCCAGCGCCGAAGTTGGTAGATCTACTGAAAATCGCCGCAGAATCA
GAACGCCAAGAGCACCCGGACAGCAGCAAAGCGGACGAGGCCGATTCCATCTTCGCCAATGCACCGGAGATGATA
GCGCGCACGCTCATCGACCGTCGCGAAATGCTGAACGAGTACTTCTCGCTGCAGATCAGTCCCGACGGAGACTTG
CTTTCCATCCCGCTGTTGCTGAAGGGGTATCTGCCTGCGCTGGCGAAACTGCCTCGTTTCCTGCTGAGGCTTGGG
CCGTATGTGGACTGGGACAGTGAGGAGGGTTGTTTCCGTACATTTTTGCGTGAGCTGGCTGCTTTTTACACGCCT
GAGCAGCTTCCGGTTCTGTCGCGGCCTGTTGCGCAGGACGCGCTGGGGGAGTCGGTTACGCAGGGGCCGGTGGTA
GCCGATGACTCTGGGGTCGAGGATGAAGATGCTTTTGTTAGGGCGCGTCGTGCACAGATGGTTCGCATGTTGGAG
TATGCTATTTTCCCGGCTCTCCGTGCGCGGCTGGTTGCCACGTCACGGCTGCTGCGGGGTGTGGTTGAGGTTGCA
GATCTAAAGGGGCTATATCGGGTGTTTGAGCGCTGTTGA
Gene >Pro_DTO377G3_2|g167.t1
ATGGAAGACGATATGAATATTGAGCCTATCGATCAACGCGGCACCAAGCGCGCCGTAGAGGAAGATGAGCCTCTG
GAACCCCCTAAACCAAAGAAAATCAAGGTACAGTAACGCGTGCACATGAAACCAATCGGATACTATCACATACCA
GAAATACTAAATTCCGTACAGGCTTTGGATCCCGATGTCGTAAATAAAATTGCTGCTGGGGAGATTATCGTTGCT
CCAATGCACGCACTGAAGGAGCTCATCGAAAACGCCGTCGATGCTGGCTCCACCTCGATTGAAGTCCTAATTAAG
GAAGGGGGTCTGAAACTACTCCAGATTACTGATAATGGCCATGGCATTGATGTAAGTCATTTTTAAGATTATAGC
AGCCGGCTCTAACATTATCTAGCGAGACGATCTCCCTATTCTCTGCGAGAGATTCACTACATCTAAGCTCAAAGA
ATTCGAAGATTTGACCTCCATTGGAACATACGGATTCCGCGGTGAAGCTCTAGCTAGTATCAGTCATATCGCACA
TCTGACGGTTACAACGAAGACTGCTGGATCCAGCTGCGCCTGGCGAGCACATTACGGAGATGGCAAATTGATACC
GGCAAAGCCAGGCCAGAATTCCGCACCCAAGGCAACGGCTGGCCGAGGGGGAACTCAAATTACCGTAAGTTAAAC
CGATGAAAATATGGCAACTTTCAAGTTAACGGAGCCCAAGGTCGAGGATCTCTTCTATAACGTTCCCACTCGACG
GAGAGCATTCCGCTCGGCAAGCGAGGAATATGCTAAAATCCTTGATGTCGTTGGCCGGTACGCAGTGCATTGCTC
CGGAGTTGCTTTCTCATGCCGCAAGCACGGAGACTCCGGTGTGAGCATATCAACTCCAGTCAGCGCAAATACTGT
CGACCGGATCCGCCAGATCCACGGCAGTGCCGTGGCAAACGAACTTGTTGAATTCAAAACAGAGGATACCAAGTT
CGGATTTCACGCATCCGGCTTCGCTACCAACGCCAACTATCATGTCAAGAAGACAGTAATTCTGCTTTTCATAAA
TCACCGCGCAGTAGAGTCAACCGCTGTTAAGCGTGCAGTTGAACAGACTTACTCTGCCTTTTTGCCCAAAGGCGG
CCATCCTTTCGTCTATCTTGATCTCGAGGTCGAGCCTAGCCGCGTCGACGTGAATGTACACCCGACAAAGCGGGA
AGTAAATTTCCTAAATGAAGACGAGATCATTGAACTTGTTTGCGCTGAAATCCGATCCAAGCTGGTTGAGGTAGA
TTCGAGTCGCACGTTCCTGACACAAAGTCTCCTACCTGGCGTGCAGACAATCGAGTCACTACAACGCGATCGAGA
CGCTCAAACTCACGAGGGAACAGCAGAGGCAACAAAAGCCGGAGCGACGCCCAAAACGCCCGCAACGGCTAAGAG
ACCCTACGAAAACAACCTCATAAGAACAGACTCAAAAGTCCGCAAAATCACGGCAATGCTAGGCCCAGCCGCCTC
ACCTCGCGACCCATCCAACCCAGACGCACCCACAGAACCCAACGACCCAACGACATCAATTCTAGACAACGGCCT
CCAATACGAAACAACCGATCGCCAACCCCTAAAGATCGCCCTCTCATCCGTCAAGGGTCTCCGAGCCGCCGTCCG
CTCCGAGATGCACAACACACTAACCGAGATGTTCGCGTCACACACATACGTCGGACTAGTGGACGAACGACGCCG
ACTCGCAGCAATCCAATCAGGCGTGAAGCTATACCTAATCGACTACGGACTCGCATGCCACGAATTCTTCTACCA
AGTAGGCCTAACCGACTTCGGCAACTTCGGCGTAATCCGCCTAGACCCAGCGCCGAAGTTGGTAGATCTACTGAA
AATCGCCGCAGAATCAGAACGCCAAGAGCACCCGGACAGCAGCAAAGCGGACGAGGCCGATTCCATCTTCGCCAA
TGCACCGGAGATGATAGCGCGCACGCTCATCGACCGTCGCGAAATGCTGAACGAGTACTTCTCGCTGCAGATCAG
TCCCGACGGAGACTTGCTTTCCATCCCGCTGTTGCTGAAGGGGTATCTGCCTGCGCTGGCGAAACTGCCTCGTTT
CCTGCTGAGGCTTGGGCCGTATGTGGACTGGGACAGTGAGGAGGGTTGTTTCCGTACATTTTTGCGTGAGCTGGC
TGCTTTTTACACGCCTGAGCAGCTTCCGGTTCTGTCGCGGCCTGTTGCGCAGGACGCGCTGGGGGAGTCGGTTAC
GCAGGGGCCGGTGGTAGCCGATGACTCTGGGGTCGAGGATGAAGATGCTTTTGTTAGGGCGCGTCGTGCACAGAT
GGTTCGCATGTTGGAGTATGCTATTTTCCCGGCTCTCCGTGCGCGGCTGGTTGCCACGTCACGGCTGCTGCGGGG
TGTGGTTGAGGTTGCAGATCTAAAGGGGCTATATCGGGTGTTTGAGCGCTGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail