Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g1664.t1
Gene name
Locationscaffold_02:548913..549906
Strand+
Gene length (bp)993
Transcript length (bp)993
Coding sequence length (bp)993
Protein length (aa) 331

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.5

Transmembrane Domains

Domain # Start End Length
1 25 47 22
2 54 76 22
3 86 108 22
4 127 149 22
5 204 226 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 18.58 8.06 29.11
5d_25C Five days - 25 degrees Celsius 18.47 8.11 28.83
7d_25C Seven days - 25 degrees Celsius 20.81 9.42 32.20
10d_25C Ten days - 25 degrees Celsius 29.18 14.51 43.86
7d_15C Seven days - 15 degrees Celsius 12.90 4.95 20.85
7d_30C Seven days - 30 degrees Celsius 21.94 10.14 33.74

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.990025 no
3d_25C 7d_25C 0.784022 no
3d_25C 7d_15C 0.287882 no
3d_25C 7d_30C 0.670335 no
3d_25C 10d_25C 0.127752 no
5d_25C 7d_25C 0.770831 no
5d_25C 7d_15C 0.301341 no
5d_25C 7d_30C 0.657520 no
5d_25C 10d_25C 0.122452 no
7d_25C 7d_15C 0.132803 no
7d_25C 7d_30C 0.908063 no
7d_25C 10d_25C 0.269326 no
7d_15C 7d_30C 0.100042 no
7d_15C 10d_25C 0.005626 yes
7d_30C 10d_25C 0.377315 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g1664.t1
MSDVPLDMLNGISGALAKEGDVRQMILVAFIGLSCYNVAELIVLVPATFRRWRGLYFWALLVSGVLGVVPYSVGF
LMKFFTHTDSVLSVTVLTIGWWTMVTGQSVVLYSRLHLVLRDERVLRRVLQLIVANIFLLHVPTTILTYGANIVH
SGDDAWINGYNIMEKIQLTGFTIQESLLSTLYVIETVKLLRLGADVSSRPDARSIMYQLIGINCAIIAMDLVLLS
LEYADLYAAQITVKGFIYSLKLKLEFAVLGRLVDLIQGSRHPISIAIADTLPLCSMQRPPETPDRGDDVLYEQAE
PKDFLAPPVGGRVVQRRMFVESGRTALLAI*
Coding >Pro_DTO377G3_2|g1664.t1
ATGTCCGACGTTCCCCTGGACATGCTGAACGGGATATCCGGTGCGCTCGCGAAAGAAGGCGACGTACGACAGATG
ATCCTCGTCGCCTTCATCGGACTATCATGCTACAACGTCGCCGAGCTAATTGTCCTCGTGCCAGCCACATTCCGC
CGGTGGCGCGGGCTCTATTTCTGGGCCCTGCTCGTCTCAGGCGTGCTCGGCGTGGTACCATACTCGGTCGGCTTC
CTGATGAAGTTCTTTACTCACACGGACTCCGTGCTGTCGGTTACTGTCCTGACTATCGGCTGGTGGACGATGGTG
ACGGGCCAATCCGTGGTGCTGTACTCACGGCTGCACCTTGTGCTACGAGACGAGCGCGTGCTGCGCCGTGTATTG
CAGCTCATCGTCGCGAATATCTTTCTCCTGCACGTGCCCACGACGATCCTCACTTACGGCGCGAATATAGTGCAC
AGCGGCGACGACGCCTGGATCAACGGGTACAATATCATGGAGAAGATCCAGCTGACCGGGTTCACGATCCAAGAG
AGTCTGCTGTCAACGCTGTATGTGATTGAGACGGTCAAGCTGCTGCGCCTTGGCGCGGATGTGTCCTCGCGCCCG
GATGCACGGAGCATCATGTACCAGCTGATCGGGATCAACTGCGCGATCATAGCGATGGATTTGGTGCTTTTGAGT
CTTGAATATGCCGATCTGTACGCCGCGCAAATCACCGTAAAGGGTTTCATTTACTCGCTCAAACTCAAGCTTGAG
TTTGCTGTGCTTGGTCGTCTGGTGGATCTCATTCAGGGGTCTAGACATCCTATCTCCATCGCTATTGCCGATACG
TTGCCTCTTTGCTCGATGCAGAGGCCGCCCGAGACGCCTGATCGCGGCGACGATGTGCTTTACGAGCAGGCTGAG
CCGAAGGACTTTTTGGCTCCGCCGGTCGGAGGCCGAGTTGTTCAGAGGAGGATGTTTGTGGAGTCTGGAAGGACG
GCTTTATTAGCAATATGA
Transcript >Pro_DTO377G3_2|g1664.t1
ATGTCCGACGTTCCCCTGGACATGCTGAACGGGATATCCGGTGCGCTCGCGAAAGAAGGCGACGTACGACAGATG
ATCCTCGTCGCCTTCATCGGACTATCATGCTACAACGTCGCCGAGCTAATTGTCCTCGTGCCAGCCACATTCCGC
CGGTGGCGCGGGCTCTATTTCTGGGCCCTGCTCGTCTCAGGCGTGCTCGGCGTGGTACCATACTCGGTCGGCTTC
CTGATGAAGTTCTTTACTCACACGGACTCCGTGCTGTCGGTTACTGTCCTGACTATCGGCTGGTGGACGATGGTG
ACGGGCCAATCCGTGGTGCTGTACTCACGGCTGCACCTTGTGCTACGAGACGAGCGCGTGCTGCGCCGTGTATTG
CAGCTCATCGTCGCGAATATCTTTCTCCTGCACGTGCCCACGACGATCCTCACTTACGGCGCGAATATAGTGCAC
AGCGGCGACGACGCCTGGATCAACGGGTACAATATCATGGAGAAGATCCAGCTGACCGGGTTCACGATCCAAGAG
AGTCTGCTGTCAACGCTGTATGTGATTGAGACGGTCAAGCTGCTGCGCCTTGGCGCGGATGTGTCCTCGCGCCCG
GATGCACGGAGCATCATGTACCAGCTGATCGGGATCAACTGCGCGATCATAGCGATGGATTTGGTGCTTTTGAGT
CTTGAATATGCCGATCTGTACGCCGCGCAAATCACCGTAAAGGGTTTCATTTACTCGCTCAAACTCAAGCTTGAG
TTTGCTGTGCTTGGTCGTCTGGTGGATCTCATTCAGGGGTCTAGACATCCTATCTCCATCGCTATTGCCGATACG
TTGCCTCTTTGCTCGATGCAGAGGCCGCCCGAGACGCCTGATCGCGGCGACGATGTGCTTTACGAGCAGGCTGAG
CCGAAGGACTTTTTGGCTCCGCCGGTCGGAGGCCGAGTTGTTCAGAGGAGGATGTTTGTGGAGTCTGGAAGGACG
GCTTTATTAGCAATATGA
Gene >Pro_DTO377G3_2|g1664.t1
ATGTCCGACGTTCCCCTGGACATGCTGAACGGGATATCCGGTGCGCTCGCGAAAGAAGGCGACGTACGACAGATG
ATCCTCGTCGCCTTCATCGGACTATCATGCTACAACGTCGCCGAGCTAATTGTCCTCGTGCCAGCCACATTCCGC
CGGTGGCGCGGGCTCTATTTCTGGGCCCTGCTCGTCTCAGGCGTGCTCGGCGTGGTACCATACTCGGTCGGCTTC
CTGATGAAGTTCTTTACTCACACGGACTCCGTGCTGTCGGTTACTGTCCTGACTATCGGCTGGTGGACGATGGTG
ACGGGCCAATCCGTGGTGCTGTACTCACGGCTGCACCTTGTGCTACGAGACGAGCGCGTGCTGCGCCGTGTATTG
CAGCTCATCGTCGCGAATATCTTTCTCCTGCACGTGCCCACGACGATCCTCACTTACGGCGCGAATATAGTGCAC
AGCGGCGACGACGCCTGGATCAACGGGTACAATATCATGGAGAAGATCCAGCTGACCGGGTTCACGATCCAAGAG
AGTCTGCTGTCAACGCTGTATGTGATTGAGACGGTCAAGCTGCTGCGCCTTGGCGCGGATGTGTCCTCGCGCCCG
GATGCACGGAGCATCATGTACCAGCTGATCGGGATCAACTGCGCGATCATAGCGATGGATTTGGTGCTTTTGAGT
CTTGAATATGCCGATCTGTACGCCGCGCAAATCACCGTAAAGGGTTTCATTTACTCGCTCAAACTCAAGCTTGAG
TTTGCTGTGCTTGGTCGTCTGGTGGATCTCATTCAGGGGTCTAGACATCCTATCTCCATCGCTATTGCCGATACG
TTGCCTCTTTGCTCGATGCAGAGGCCGCCCGAGACGCCTGATCGCGGCGACGATGTGCTTTACGAGCAGGCTGAG
CCGAAGGACTTTTTGGCTCCGCCGGTCGGAGGCCGAGTTGTTCAGAGGAGGATGTTTGTGGAGTCTGGAAGGACG
GCTTTATTAGCAATATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail