Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g1662.t1
Gene name
Locationscaffold_02:545384..546671
Strand-
Gene length (bp)1287
Transcript length (bp)1287
Coding sequence length (bp)1287
Protein length (aa) 429

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03473 MOSC MOSC domain 1.6E-23 277 406
PF03476 MOSC_N MOSC N-terminal beta barrel domain 3.3E-06 81 118

GO

GO Term Description Terminal node
GO:0030170 pyridoxal phosphate binding Yes
GO:0030151 molybdenum ion binding Yes
GO:0003824 catalytic activity Yes
GO:0046914 transition metal ion binding No
GO:0097159 organic cyclic compound binding No
GO:0005488 binding No
GO:0043167 ion binding No
GO:0070279 vitamin B6 binding No
GO:0043169 cation binding No
GO:0019842 vitamin binding No
GO:0046872 metal ion binding No
GO:0043168 anion binding No
GO:1901363 heterocyclic compound binding No
GO:0003674 molecular_function No
GO:0036094 small molecule binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 37 0.5

Transmembrane Domains

Domain # Start End Length
1 12 29 17

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 26.05 13.36 38.73
5d_25C Five days - 25 degrees Celsius 16.69 7.57 25.81
7d_25C Seven days - 25 degrees Celsius 18.34 8.39 28.28
10d_25C Ten days - 25 degrees Celsius 11.51 4.35 18.66
7d_15C Seven days - 15 degrees Celsius 15.78 6.32 25.23
7d_30C Seven days - 30 degrees Celsius 11.76 4.62 18.91

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.124307 no
3d_25C 7d_25C 0.245501 no
3d_25C 7d_15C 0.106191 no
3d_25C 7d_30C 0.007091 yes
3d_25C 10d_25C 0.003197 yes
5d_25C 7d_25C 0.821011 no
5d_25C 7d_15C 0.909083 no
5d_25C 7d_30C 0.316649 no
5d_25C 10d_25C 0.271936 no
7d_25C 7d_15C 0.718255 no
7d_25C 7d_30C 0.178358 no
7d_25C 10d_25C 0.145487 no
7d_15C 7d_30C 0.454099 no
7d_15C 10d_25C 0.405564 no
7d_30C 10d_25C 0.968152 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g1662.t1
MSNVDISLGDDIVPNWFILFFLSVLFLSLKTLKTLTAPINPKGCRRLGLPPGQSNLDDEFDSKYSQGLPSNQDDH
GRPSWRVKALFSYPLKSCGAVELQVSNVVPTGLEFDRQFVFAEYINDEWTIRTLRNASFNCLALIHPEIWVPDPS
APDYNADLSEVKSQGVMLISYPRIPPAGWKGLPIKLGMALKFLKSQRTFQVPLLPPADSKFPLVPVKIWKDKPLA
HDYGRLLPASLHAYLGSDPSKKTLTLFRASAPHSRQIFRNAPRKEDLGFQPSTAFADAYPIHLLSISSHRDVAAR
CAYAIPRLSIRRFRANIIIQGPSAFEEDHWKRLAIGGTEIHASCRTVRCRLPNVDPLSGDRHNAEPDRTLKSYRR
IDDGDRTNACLGMQLVPAKEEFVVRVGDSVEVLETGVHRYIKMLAPGEKVEGV*
Coding >Pro_DTO377G3_2|g1662.t1
ATGTCCAATGTTGACATTTCCCTCGGGGATGATATCGTCCCCAATTGGTTTATTCTATTCTTTCTATCTGTGCTT
TTTCTTTCTCTGAAGACATTGAAAACACTGACAGCGCCAATCAATCCCAAGGGATGTCGCCGCCTAGGACTTCCG
CCAGGCCAAAGCAACCTAGACGATGAGTTCGACTCAAAGTACAGCCAGGGTCTACCTAGCAATCAAGATGATCAC
GGCCGTCCGTCCTGGCGCGTAAAGGCATTGTTCAGCTACCCGCTCAAATCCTGTGGCGCAGTCGAGCTGCAAGTC
TCAAACGTCGTACCAACTGGACTTGAATTTGATAGACAATTCGTCTTTGCAGAGTACATCAATGACGAATGGACC
ATTCGTACCCTGCGAAATGCAAGCTTCAATTGTCTAGCCTTGATCCATCCGGAGATCTGGGTTCCTGACCCGTCT
GCCCCAGATTACAACGCAGACCTGTCAGAAGTCAAGTCGCAGGGTGTGATGTTGATATCGTATCCCCGAATTCCG
CCAGCAGGATGGAAGGGTCTGCCCATCAAGCTCGGCATGGCACTCAAGTTCCTCAAAAGCCAACGGACATTCCAA
GTCCCGCTACTTCCCCCCGCGGACTCCAAGTTCCCACTAGTCCCAGTCAAGATCTGGAAAGACAAGCCCCTAGCC
CATGACTACGGCAGACTGCTCCCAGCATCATTACACGCATATCTAGGGTCCGACCCATCAAAAAAGACCCTGACA
CTCTTCCGCGCCAGTGCACCCCATTCACGGCAGATCTTCCGTAACGCACCGCGCAAAGAAGACCTAGGCTTCCAG
CCAAGCACAGCCTTCGCAGACGCGTATCCAATCCACCTGCTCAGCATCTCCAGTCACCGGGATGTAGCAGCACGC
TGTGCCTACGCAATCCCGCGATTGAGCATTCGCCGTTTCCGCGCGAACATCATCATTCAAGGCCCGTCTGCTTTT
GAGGAAGATCACTGGAAGCGGCTTGCTATTGGCGGTACCGAGATCCACGCTTCTTGTCGGACTGTCCGGTGTCGA
CTGCCTAATGTCGATCCGCTGTCCGGGGATAGACATAATGCTGAGCCGGATCGGACGCTAAAGTCGTATCGGCGG
ATTGATGATGGCGATCGGACCAATGCGTGTTTAGGGATGCAGCTTGTTCCTGCGAAGGAGGAGTTTGTGGTTAGG
GTTGGGGATTCTGTTGAGGTTCTTGAGACCGGGGTGCACCGGTATATTAAGATGTTGGCCCCCGGGGAGAAGGTC
GAGGGGGTGTAA
Transcript >Pro_DTO377G3_2|g1662.t1
ATGTCCAATGTTGACATTTCCCTCGGGGATGATATCGTCCCCAATTGGTTTATTCTATTCTTTCTATCTGTGCTT
TTTCTTTCTCTGAAGACATTGAAAACACTGACAGCGCCAATCAATCCCAAGGGATGTCGCCGCCTAGGACTTCCG
CCAGGCCAAAGCAACCTAGACGATGAGTTCGACTCAAAGTACAGCCAGGGTCTACCTAGCAATCAAGATGATCAC
GGCCGTCCGTCCTGGCGCGTAAAGGCATTGTTCAGCTACCCGCTCAAATCCTGTGGCGCAGTCGAGCTGCAAGTC
TCAAACGTCGTACCAACTGGACTTGAATTTGATAGACAATTCGTCTTTGCAGAGTACATCAATGACGAATGGACC
ATTCGTACCCTGCGAAATGCAAGCTTCAATTGTCTAGCCTTGATCCATCCGGAGATCTGGGTTCCTGACCCGTCT
GCCCCAGATTACAACGCAGACCTGTCAGAAGTCAAGTCGCAGGGTGTGATGTTGATATCGTATCCCCGAATTCCG
CCAGCAGGATGGAAGGGTCTGCCCATCAAGCTCGGCATGGCACTCAAGTTCCTCAAAAGCCAACGGACATTCCAA
GTCCCGCTACTTCCCCCCGCGGACTCCAAGTTCCCACTAGTCCCAGTCAAGATCTGGAAAGACAAGCCCCTAGCC
CATGACTACGGCAGACTGCTCCCAGCATCATTACACGCATATCTAGGGTCCGACCCATCAAAAAAGACCCTGACA
CTCTTCCGCGCCAGTGCACCCCATTCACGGCAGATCTTCCGTAACGCACCGCGCAAAGAAGACCTAGGCTTCCAG
CCAAGCACAGCCTTCGCAGACGCGTATCCAATCCACCTGCTCAGCATCTCCAGTCACCGGGATGTAGCAGCACGC
TGTGCCTACGCAATCCCGCGATTGAGCATTCGCCGTTTCCGCGCGAACATCATCATTCAAGGCCCGTCTGCTTTT
GAGGAAGATCACTGGAAGCGGCTTGCTATTGGCGGTACCGAGATCCACGCTTCTTGTCGGACTGTCCGGTGTCGA
CTGCCTAATGTCGATCCGCTGTCCGGGGATAGACATAATGCTGAGCCGGATCGGACGCTAAAGTCGTATCGGCGG
ATTGATGATGGCGATCGGACCAATGCGTGTTTAGGGATGCAGCTTGTTCCTGCGAAGGAGGAGTTTGTGGTTAGG
GTTGGGGATTCTGTTGAGGTTCTTGAGACCGGGGTGCACCGGTATATTAAGATGTTGGCCCCCGGGGAGAAGGTC
GAGGGGGTGTAA
Gene >Pro_DTO377G3_2|g1662.t1
ATGTCCAATGTTGACATTTCCCTCGGGGATGATATCGTCCCCAATTGGTTTATTCTATTCTTTCTATCTGTGCTT
TTTCTTTCTCTGAAGACATTGAAAACACTGACAGCGCCAATCAATCCCAAGGGATGTCGCCGCCTAGGACTTCCG
CCAGGCCAAAGCAACCTAGACGATGAGTTCGACTCAAAGTACAGCCAGGGTCTACCTAGCAATCAAGATGATCAC
GGCCGTCCGTCCTGGCGCGTAAAGGCATTGTTCAGCTACCCGCTCAAATCCTGTGGCGCAGTCGAGCTGCAAGTC
TCAAACGTCGTACCAACTGGACTTGAATTTGATAGACAATTCGTCTTTGCAGAGTACATCAATGACGAATGGACC
ATTCGTACCCTGCGAAATGCAAGCTTCAATTGTCTAGCCTTGATCCATCCGGAGATCTGGGTTCCTGACCCGTCT
GCCCCAGATTACAACGCAGACCTGTCAGAAGTCAAGTCGCAGGGTGTGATGTTGATATCGTATCCCCGAATTCCG
CCAGCAGGATGGAAGGGTCTGCCCATCAAGCTCGGCATGGCACTCAAGTTCCTCAAAAGCCAACGGACATTCCAA
GTCCCGCTACTTCCCCCCGCGGACTCCAAGTTCCCACTAGTCCCAGTCAAGATCTGGAAAGACAAGCCCCTAGCC
CATGACTACGGCAGACTGCTCCCAGCATCATTACACGCATATCTAGGGTCCGACCCATCAAAAAAGACCCTGACA
CTCTTCCGCGCCAGTGCACCCCATTCACGGCAGATCTTCCGTAACGCACCGCGCAAAGAAGACCTAGGCTTCCAG
CCAAGCACAGCCTTCGCAGACGCGTATCCAATCCACCTGCTCAGCATCTCCAGTCACCGGGATGTAGCAGCACGC
TGTGCCTACGCAATCCCGCGATTGAGCATTCGCCGTTTCCGCGCGAACATCATCATTCAAGGCCCGTCTGCTTTT
GAGGAAGATCACTGGAAGCGGCTTGCTATTGGCGGTACCGAGATCCACGCTTCTTGTCGGACTGTCCGGTGTCGA
CTGCCTAATGTCGATCCGCTGTCCGGGGATAGACATAATGCTGAGCCGGATCGGACGCTAAAGTCGTATCGGCGG
ATTGATGATGGCGATCGGACCAATGCGTGTTTAGGGATGCAGCTTGTTCCTGCGAAGGAGGAGTTTGTGGTTAGG
GTTGGGGATTCTGTTGAGGTTCTTGAGACCGGGGTGCACCGGTATATTAAGATGTTGGCCCCCGGGGAGAAGGTC
GAGGGGGTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail