Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g1658.t1
Gene name
Locationscaffold_02:535023..538294
Strand-
Gene length (bp)3271
Transcript length (bp)2883
Coding sequence length (bp)2883
Protein length (aa) 961

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01432 Peptidase_M3 Peptidase family M3 2.2E-161 220 712

GO

GO Term Description Terminal node
GO:0006508 proteolysis Yes
GO:0004222 metalloendopeptidase activity Yes
GO:0008152 metabolic process No
GO:0071704 organic substance metabolic process No
GO:0016787 hydrolase activity No
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0008233 peptidase activity No
GO:0140096 catalytic activity, acting on a protein No
GO:0043170 macromolecule metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0004175 endopeptidase activity No
GO:1901564 organonitrogen compound metabolic process No
GO:0019538 protein metabolic process No
GO:0044238 primary metabolic process No
GO:0008150 biological_process No
GO:0008237 metallopeptidase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 80.54 48.94 112.13
5d_25C Five days - 25 degrees Celsius 67.30 41.13 93.47
7d_25C Seven days - 25 degrees Celsius 55.94 34.34 77.53
10d_25C Ten days - 25 degrees Celsius 56.09 34.41 77.77
7d_15C Seven days - 15 degrees Celsius 84.93 51.53 118.32
7d_30C Seven days - 30 degrees Celsius 65.42 39.98 90.86

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.470774 no
3d_25C 7d_25C 0.083660 no
3d_25C 7d_15C 0.864654 no
3d_25C 7d_30C 0.394684 no
3d_25C 10d_25C 0.089476 no
5d_25C 7d_25C 0.453442 no
5d_25C 7d_15C 0.323260 no
5d_25C 7d_30C 0.935771 no
5d_25C 10d_25C 0.463588 no
7d_25C 7d_15C 0.042216 yes
7d_25C 7d_30C 0.544036 no
7d_25C 10d_25C 0.994202 no
7d_15C 7d_30C 0.255646 no
7d_15C 10d_25C 0.045957 yes
7d_30C 10d_25C 0.552682 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g1658.t1
MAPAHLRKPPQAPPVFTATPQSLLADAERLIKSSRAIQDKVVAEVKPEAATFAKVVLPLAQDDNQMGLESHILGF
YQAVSTDSKLRDASSKAEELMDEFFIEAVMREDVFNLVDAVLRRNEILDPESRRLLEKEHKDFIRNGLGLPDGPH
RLRFKEIKKRLSQLSIEFQKNLNEENGGIWFTPEQLAGVPKDLLDGLKKGEDENAGKLWLSFKYPDLFPTMKYAS
DPETRRQVMIANENKCNQNVPLFRESIILRDEAARLIGYPNHAAFRIEDKMAKTPETVNKFLGDLRDRLTAGGKK
EIQKLLDLKNATDPNADGRYYLWDHRFYDRLMLEKDYSLDHQLIAEWFPLQTTIQGMLKIFEELFGLEFVEIIGE
DRAAIAPTGQGNDIVWHEDVQVFSVWNDEDAGSGFVGYLYLDLFPREGKYGHAANFNLQPGFINKDGTRRFPATA
LVCNFTKPQPKKPSLLKHDEVVTLFHELGHGIHDLVSRTIYSRFHGTSTVRDFVEAPSQMLENWCWEPSQLRSLS
RHYSTLSPEYLASWKEAQGEAATSQPSERIPDDVIANLIRTKHVNDSLFNLRQLHFGIFDMTVHEPKTHADIEAL
PLSATYNRLRHEITQMDGPEVQGAGDEWGHGEATFGHLIGGYDAGYYGYLSSQVYSTDMFYTVFKDDPMNKAAGR
RYRYQVLEKGGSQDEMKTLTEFLGRAPRTDAFYKDLGLALAVDTDKRTALPFCNSPQLNSSFSRSSHFRTSAYKT
TQSLGLNKCIQSPLCITNIRDQSASAQQLQIPDSYQFKSATTTRNISTLPRRGGEGKDKALILPLERKSSTDADA
DADIEADLEEEARTTETEPSSRKTRARHVSNHTTLLLATTIPDRRATIIRREDGIEKRILLRCGRCKVVVGYYLD
RLHWASTGDRERERGGARDGEEEGEEERPPAVYLLPGAVVETEKLGGEGVGEREWREWVV*
Coding >Pro_DTO377G3_2|g1658.t1
ATGGCCCCCGCTCACCTCCGGAAGCCACCCCAGGCCCCGCCTGTCTTTACCGCAACCCCGCAGTCACTTCTAGCT
GATGCCGAGCGCTTGATCAAGAGCTCGCGAGCCATTCAGGACAAGGTGGTGGCGGAGGTCAAGCCCGAGGCCGCA
ACCTTTGCCAAGGTTGTCCTTCCTCTCGCCCAAGATGACAACCAGATGGGACTAGAGTCACACATCCTGGGCTTC
TACCAGGCTGTATCAACAGACTCGAAGCTGCGAGATGCTTCTTCCAAGGCCGAAGAGCTGATGGATGAGTTCTTT
ATTGAGGCGGTCATGCGTGAGGATGTCTTCAATTTGGTCGATGCCGTACTGCGCCGCAACGAGATTCTCGATCCG
GAGTCACGCCGTCTATTGGAGAAGGAACACAAGGACTTCATCCGTAATGGACTCGGCCTGCCCGATGGCCCTCAT
CGGCTCCGCTTCAAGGAGATCAAGAAGCGGCTGAGCCAGCTGAGCATTGAATTCCAGAAGAACCTGAACGAGGAG
AACGGCGGCATTTGGTTTACCCCGGAGCAGCTGGCTGGTGTGCCCAAGGACCTTCTGGACGGCCTGAAGAAGGGC
GAGGACGAGAACGCCGGCAAGCTCTGGCTGTCGTTCAAGTACCCCGACCTCTTCCCCACCATGAAATATGCCAGC
GACCCCGAGACTCGCCGGCAAGTCATGATCGCCAATGAGAACAAGTGCAACCAGAATGTGCCGCTATTCCGGGAA
TCCATTATACTCCGTGATGAGGCGGCTCGTCTGATCGGCTATCCCAACCACGCTGCCTTTCGTATCGAGGACAAG
ATGGCCAAGACCCCAGAGACCGTTAACAAGTTTTTGGGTGATCTTCGGGACAGACTGACCGCTGGCGGGAAGAAG
GAGATACAGAAGTTGCTGGATTTGAAGAACGCCACGGACCCCAATGCTGATGGCCGCTACTACCTGTGGGACCAC
CGATTCTATGACCGTCTCATGCTAGAAAAGGACTACTCGCTAGACCACCAGCTTATTGCTGAGTGGTTCCCCTTG
CAGACAACCATTCAAGGTATGCTGAAGATTTTCGAAGAGCTGTTCGGTCTGGAGTTTGTTGAGATCATTGGTGAG
GACCGGGCAGCCATTGCCCCCACTGGCCAGGGCAATGACATTGTCTGGCACGAGGATGTCCAAGTATTCAGTGTG
TGGAACGATGAGGACGCGGGCAGTGGGTTCGTTGGATACCTGTACCTGGACCTGTTCCCTCGCGAGGGCAAATAT
GGCCATGCAGCCAACTTCAACCTGCAGCCGGGCTTCATTAATAAGGATGGTACCCGCCGATTCCCTGCCACCGCA
TTGGTGTGCAACTTCACCAAGCCCCAGCCCAAGAAGCCTAGTCTGCTGAAGCACGACGAGGTCGTGACCCTCTTC
CACGAACTCGGCCACGGCATCCACGACCTGGTGTCCCGAACCATCTACTCCCGCTTCCACGGTACCAGCACAGTG
CGCGACTTTGTCGAGGCACCCAGCCAGATGCTGGAGAACTGGTGCTGGGAACCCTCGCAGCTGCGCTCTCTGAGC
CGACACTACTCCACCCTCTCCCCAGAGTACCTTGCTAGCTGGAAGGAGGCTCAGGGCGAAGCTGCCACCAGCCAG
CCGTCAGAGCGCATCCCGGACGATGTCATTGCCAACCTGATTCGCACCAAGCACGTCAACGACTCCCTATTCAAC
CTGCGCCAGCTGCACTTCGGCATCTTTGACATGACCGTCCACGAGCCCAAGACCCACGCCGACATTGAGGCTCTT
CCTCTGTCTGCGACATACAACCGTCTCCGCCATGAGATTACCCAGATGGACGGACCGGAAGTACAGGGCGCTGGC
GACGAGTGGGGCCACGGCGAGGCGACCTTTGGACATTTGATCGGAGGTTACGACGCTGGATACTACGGATACCTG
AGCTCCCAAGTTTACTCCACCGACATGTTCTACACCGTCTTCAAGGACGATCCCATGAACAAGGCTGCTGGCCGT
CGCTACCGCTACCAGGTTCTAGAGAAGGGTGGTAGCCAGGATGAGATGAAGACTCTGACCGAGTTCTTAGGCCGT
GCGCCTCGGACCGATGCATTCTACAAGGATTTGGGACTGGCGTTAGCTGTAGATACCGATAAGCGCACCGCCTTG
CCATTCTGCAATTCTCCGCAACTCAACAGCTCTTTTTCTAGATCGTCTCATTTTAGAACTTCAGCATACAAGACA
ACACAGAGTCTCGGATTAAACAAGTGTATCCAATCACCGCTCTGCATCACCAACATAAGAGATCAATCTGCCTCC
GCGCAGCAGCTCCAAATTCCCGACTCCTATCAGTTCAAAAGCGCGACAACAACCCGCAACATAAGCACCCTACCG
CGGCGCGGCGGCGAAGGAAAAGACAAAGCGCTGATTCTGCCCCTCGAGCGCAAGAGCTCAACAGACGCAGACGCA
GATGCGGATATAGAAGCCGACCTCGAAGAAGAAGCCAGGACCACAGAAACAGAACCGTCATCGCGCAAGACAAGA
GCAAGGCATGTCTCTAACCACACGACGCTTCTGCTGGCTACTACGATCCCGGACCGGCGGGCGACGATTATCCGG
CGCGAAGACGGGATCGAGAAGAGGATTCTGTTGAGGTGTGGGCGGTGCAAGGTTGTTGTGGGGTATTATTTGGAT
CGGTTGCATTGGGCGTCTACTGGGGATCGAGAGAGGGAGAGGGGAGGGGCGCGGGATGGGGAGGAGGAGGGGGAG
GAGGAGCGGCCGCCGGCTGTTTATCTTCTTCCTGGGGCTGTGGTGGAGACGGAGAAGTTGGGGGGTGAGGGGGTT
GGGGAGAGGGAGTGGAGGGAGTGGGTTGTTTAG
Transcript >Pro_DTO377G3_2|g1658.t1
ATGGCCCCCGCTCACCTCCGGAAGCCACCCCAGGCCCCGCCTGTCTTTACCGCAACCCCGCAGTCACTTCTAGCT
GATGCCGAGCGCTTGATCAAGAGCTCGCGAGCCATTCAGGACAAGGTGGTGGCGGAGGTCAAGCCCGAGGCCGCA
ACCTTTGCCAAGGTTGTCCTTCCTCTCGCCCAAGATGACAACCAGATGGGACTAGAGTCACACATCCTGGGCTTC
TACCAGGCTGTATCAACAGACTCGAAGCTGCGAGATGCTTCTTCCAAGGCCGAAGAGCTGATGGATGAGTTCTTT
ATTGAGGCGGTCATGCGTGAGGATGTCTTCAATTTGGTCGATGCCGTACTGCGCCGCAACGAGATTCTCGATCCG
GAGTCACGCCGTCTATTGGAGAAGGAACACAAGGACTTCATCCGTAATGGACTCGGCCTGCCCGATGGCCCTCAT
CGGCTCCGCTTCAAGGAGATCAAGAAGCGGCTGAGCCAGCTGAGCATTGAATTCCAGAAGAACCTGAACGAGGAG
AACGGCGGCATTTGGTTTACCCCGGAGCAGCTGGCTGGTGTGCCCAAGGACCTTCTGGACGGCCTGAAGAAGGGC
GAGGACGAGAACGCCGGCAAGCTCTGGCTGTCGTTCAAGTACCCCGACCTCTTCCCCACCATGAAATATGCCAGC
GACCCCGAGACTCGCCGGCAAGTCATGATCGCCAATGAGAACAAGTGCAACCAGAATGTGCCGCTATTCCGGGAA
TCCATTATACTCCGTGATGAGGCGGCTCGTCTGATCGGCTATCCCAACCACGCTGCCTTTCGTATCGAGGACAAG
ATGGCCAAGACCCCAGAGACCGTTAACAAGTTTTTGGGTGATCTTCGGGACAGACTGACCGCTGGCGGGAAGAAG
GAGATACAGAAGTTGCTGGATTTGAAGAACGCCACGGACCCCAATGCTGATGGCCGCTACTACCTGTGGGACCAC
CGATTCTATGACCGTCTCATGCTAGAAAAGGACTACTCGCTAGACCACCAGCTTATTGCTGAGTGGTTCCCCTTG
CAGACAACCATTCAAGGTATGCTGAAGATTTTCGAAGAGCTGTTCGGTCTGGAGTTTGTTGAGATCATTGGTGAG
GACCGGGCAGCCATTGCCCCCACTGGCCAGGGCAATGACATTGTCTGGCACGAGGATGTCCAAGTATTCAGTGTG
TGGAACGATGAGGACGCGGGCAGTGGGTTCGTTGGATACCTGTACCTGGACCTGTTCCCTCGCGAGGGCAAATAT
GGCCATGCAGCCAACTTCAACCTGCAGCCGGGCTTCATTAATAAGGATGGTACCCGCCGATTCCCTGCCACCGCA
TTGGTGTGCAACTTCACCAAGCCCCAGCCCAAGAAGCCTAGTCTGCTGAAGCACGACGAGGTCGTGACCCTCTTC
CACGAACTCGGCCACGGCATCCACGACCTGGTGTCCCGAACCATCTACTCCCGCTTCCACGGTACCAGCACAGTG
CGCGACTTTGTCGAGGCACCCAGCCAGATGCTGGAGAACTGGTGCTGGGAACCCTCGCAGCTGCGCTCTCTGAGC
CGACACTACTCCACCCTCTCCCCAGAGTACCTTGCTAGCTGGAAGGAGGCTCAGGGCGAAGCTGCCACCAGCCAG
CCGTCAGAGCGCATCCCGGACGATGTCATTGCCAACCTGATTCGCACCAAGCACGTCAACGACTCCCTATTCAAC
CTGCGCCAGCTGCACTTCGGCATCTTTGACATGACCGTCCACGAGCCCAAGACCCACGCCGACATTGAGGCTCTT
CCTCTGTCTGCGACATACAACCGTCTCCGCCATGAGATTACCCAGATGGACGGACCGGAAGTACAGGGCGCTGGC
GACGAGTGGGGCCACGGCGAGGCGACCTTTGGACATTTGATCGGAGGTTACGACGCTGGATACTACGGATACCTG
AGCTCCCAAGTTTACTCCACCGACATGTTCTACACCGTCTTCAAGGACGATCCCATGAACAAGGCTGCTGGCCGT
CGCTACCGCTACCAGGTTCTAGAGAAGGGTGGTAGCCAGGATGAGATGAAGACTCTGACCGAGTTCTTAGGCCGT
GCGCCTCGGACCGATGCATTCTACAAGGATTTGGGACTGGCGTTAGCTGTAGATACCGATAAGCGCACCGCCTTG
CCATTCTGCAATTCTCCGCAACTCAACAGCTCTTTTTCTAGATCGTCTCATTTTAGAACTTCAGCATACAAGACA
ACACAGAGTCTCGGATTAAACAAGTGTATCCAATCACCGCTCTGCATCACCAACATAAGAGATCAATCTGCCTCC
GCGCAGCAGCTCCAAATTCCCGACTCCTATCAGTTCAAAAGCGCGACAACAACCCGCAACATAAGCACCCTACCG
CGGCGCGGCGGCGAAGGAAAAGACAAAGCGCTGATTCTGCCCCTCGAGCGCAAGAGCTCAACAGACGCAGACGCA
GATGCGGATATAGAAGCCGACCTCGAAGAAGAAGCCAGGACCACAGAAACAGAACCGTCATCGCGCAAGACAAGA
GCAAGGCATGTCTCTAACCACACGACGCTTCTGCTGGCTACTACGATCCCGGACCGGCGGGCGACGATTATCCGG
CGCGAAGACGGGATCGAGAAGAGGATTCTGTTGAGGTGTGGGCGGTGCAAGGTTGTTGTGGGGTATTATTTGGAT
CGGTTGCATTGGGCGTCTACTGGGGATCGAGAGAGGGAGAGGGGAGGGGCGCGGGATGGGGAGGAGGAGGGGGAG
GAGGAGCGGCCGCCGGCTGTTTATCTTCTTCCTGGGGCTGTGGTGGAGACGGAGAAGTTGGGGGGTGAGGGGGTT
GGGGAGAGGGAGTGGAGGGAGTGGGTTGTTTAG
Gene >Pro_DTO377G3_2|g1658.t1
ATGGCCCCCGCTCACCTCCGGAAGCCACCCCAGGCCCCGCCTGTCTTTACCGCAACCCCGCAGTCACTTCTAGCT
GATGCCGAGCGCTTGATCAAGAGCTCGCGAGCCATTCAGGACAAGGTGGTGGCGGAGGTCAAGCCCGAGGCCGCA
ACCTTTGCCAAGGTTGTCCTTCCTCTCGCCCAAGATGACAACCAGATGGGACTAGAGTCACACATCCTGGGCTTC
TACCAGGCTGTATCAACAGACTCGAAGCTGCGAGATGCTTCTTCCAAGGCCGAAGAGCTGATGGATGAGTTCTTT
ATTGAGGCGGTCATGCGTGAGGATGTCTTCAATTTGGTCGATGCCGTACTGCGCCGCAACGAGATTCTCGATCCG
GAGTCACGCCGTCTATTGGAGAAGGAACACAAGGACTTCATCCGTAATGGACTCGGCCTGCCCGATGGCCCTCAT
CGGCTCCGCTTCAAGGAGATCAAGAAGCGGCTGAGCCAGCTGAGCATTGAATTCCAGAAGAACCTGAACGAGGAG
AACGGCGGCATTTGGTTTACCCCGGAGCAGCTGGCTGGTGTGCCCAAGGACCTTCTGGACGGCCTGAAGAAGGGC
GAGGACGAGAACGCCGGCAAGCTCTGGCTGTCGTTCAAGTACCCCGACCTCTTCCCCACCATGAAATATGCCAGC
GACCCCGAGACTCGCCGGCAAGTCATGATCGCCAATGAGAACAAGTGCAACCAGAATGTGCCGCTATTCCGGGAA
TCCATTATACTCCGTGATGAGGCGGCTCGTCTGATCGGCTATCCCAACCACGCTGCCTTTCGTATCGAGGACAAG
ATGGCCAAGACCCCAGAGACCGTTAACAAGTTTTTGGGTGATCTTCGGGACAGACTGACCGCTGGCGGGAAGAAG
GAGATACAGAAGTTGCTGGATTTGAAGAACGCCACGGACCCCAATGCTGATGGCCGCTACTACCTGTGGGACCAC
CGATTCTATGACCGTCTCATGCTAGAAAAGGACTACTCGCTAGACCACCAGCTTATTGCTGAGTGGTTCCCCTTG
CAGACAACCATTCAAGGTATGCTGAAGATTTTCGAAGAGCTGTTCGGTCTGGAGTTTGTTGAGATCATTGGTGAG
GACCGGGCAGCCATTGCCCCCACTGGCCAGGGCAATGACATTGTCTGGCACGAGGATGTCCAAGTATTCAGTGTG
TGGAACGATGAGGACGCGGGCAGTGGGTTCGTTGGATACCTGTACCTGGACCTGTTCCCTCGCGAGGGCAAATAT
GGCCATGCAGCCAACTTCAACCTGCAGCCGGGCTTCATTAATAAGGATGGTACCCGCCGATTCCCTGCCACCGCA
TTGGTGTGCAACTTCACCAAGCCCCAGCCCAAGAAGCCTAGTCTGCTGAAGCACGACGAGGTCGTGACCCTCTTC
CACGAACTCGGCCACGGCATCCACGACCTGGTGTCCCGAACCATCTACTCCCGCTTCCACGGTACCAGCACAGTG
CGCGACTTTGTCGAGGCACCCAGCCAGATGCTGGAGAACTGGTGCTGGGAACCCTCGCAGCTGCGCTCTCTGAGC
CGACACTACTCCACCCTCTCCCCAGAGTACCTTGCTAGCTGGAAGGAGGCTCAGGGCGAAGCTGCCACCAGCCAG
CCGTCAGAGCGCATCCCGGACGATGTCATTGCCAACCTGATTCGCACCAAGCACGTCAACGACTCCCTATTCAAC
CTGCGCCAGCTGCACTTCGGCATCTTTGACATGACCGTCCACGAGCCCAAGACCCACGCCGACATTGAGGCTCTT
CCTCTGTCTGCGACATACAACCGTCTCCGCCATGAGATTACCCAGATGGACGGACCGGAAGTACAGGGCGCTGGC
GACGAGTGGGGCCACGGCGAGGCGACCTTTGGACATTTGATCGGAGGTTACGACGCTGGATACTACGGATACCTG
AGGTAAGTTATAAGTTTGTGTGATTGGTTTCAATGTTCGAATACTGATGATTTCGCTCTGCAGCTCCCAAGTTTA
CTCCACCGACATGTTCTACACCGTCTTCAAGGACGATCCCATGAACAAGGCTGCTGGCCGTCGCTACCGCTACCA
GGTTCTAGAGAAGGGTGGTAGCCAGGATGAGATGAAGACTCTGACCGAGTTCTTAGGCCGTGCGCCTCGGACCGA
TGCATTCTACAAGGATTTGGGACTGGCGTAAAGTGGTGCGTAGCATTTACAGCCATCGGGGCTTATGAACGGCTA
TAAACTATACCTATTAAATTATATAGAGCTATCCGAATGCGTATCTTGTGCTCATGAATAACGAGCAGCATGCCA
ATAACTCCTCTACTTGAACTGTCTATATCGTAGCTAACAAGTTCCAAGGTTAGCTGTAGATACCGATAAGCGCAC
CGCCTTGCCATTCTGCAATTCTCCGCAACTCAACAGCTCTTTTTCTAGATCGTCTCATTTTAGAACTTCAGCATA
CAAGACAACACAGAGTCTCGGATTAAACAAGTGTATCCAATCACCGGTAAGTACCTACTAAGCCAGCAGAAAGAT
ATTTCCTCATGAACCCCGCGCAAAAGACTAACCAAGACCCCAGCTCTGCATCACCAACATAAGAGATCAATCTGC
CTCCGCGCAGCAGCTCCAAATTCCCGACTCCTATCAGTTCAAAAGCGCGAGTCAATAACCAATTCCAAAAATGAC
CGACCACCGTCTCCCAATCCAAACCCAACATTGCCGCTTCTGCAACCACCTCCTGCTAGCAACAACCCGCAACAT
AAGCACCCTACCGCGGCGCGGCGGCGAAGGAAAAGACAAAGCGCTGATTCTGCCCCTCGAGCGCAAGAGCTCAAC
AGACGCAGACGCAGATGCGGATATAGAAGCCGACCTCGAAGAAGAAGCCAGGACCACAGAAACAGAACCGTCATC
GCGCAAGACAAGAGCAAGGCATGTCTCTAACCACACGACGCTTCTGCTGGCTACTACGATCCCGGACCGGCGGGC
GACGATTATCCGGCGCGAAGACGGGATCGAGAAGAGGATTCTGTTGAGGTGTGGGCGGTGCAAGGTTGTTGTGGG
GTATTATTTGGATCGGTTGCATTGGGCGTCTACTGGGGATCGAGAGAGGGAGAGGGGAGGGGCGCGGGATGGGGA
GGAGGAGGGGGAGGAGGAGCGGCCGCCGGCTGTTTATCTTCTTCCTGGGGCTGTGGTGGAGACGGAGAAGTTGGG
GGGTGAGGGGGTTGGGGAGAGGGAGTGGAGGGAGTGGGTTGTTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail