Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g1657.t1
Gene name
Locationscaffold_02:534130..534799
Strand+
Gene length (bp)669
Transcript length (bp)438
Coding sequence length (bp)438
Protein length (aa) 146

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13499 EF-hand_7 EF-hand domain pair 4.3E-08 83 139
PF13833 EF-hand_8 EF-hand domain pair 3.5E-05 95 134

GO

GO Term Description Terminal node
GO:0005509 calcium ion binding Yes
GO:0005488 binding No
GO:0043167 ion binding No
GO:0046872 metal ion binding No
GO:0043169 cation binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 47 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 624.16 373.12 875.19
5d_25C Five days - 25 degrees Celsius 525.22 311.35 739.10
7d_25C Seven days - 25 degrees Celsius 503.01 289.93 716.08
10d_25C Ten days - 25 degrees Celsius 363.71 212.10 515.33
7d_15C Seven days - 15 degrees Celsius 472.04 237.14 706.93
7d_30C Seven days - 30 degrees Celsius 507.02 296.42 717.61

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.517437 no
3d_25C 7d_25C 0.406173 no
3d_25C 7d_15C 0.297116 no
3d_25C 7d_30C 0.420451 no
3d_25C 10d_25C 0.010083 yes
5d_25C 7d_25C 0.903555 no
5d_25C 7d_15C 0.749235 no
5d_25C 7d_30C 0.921505 no
5d_25C 10d_25C 0.108807 no
7d_25C 7d_15C 0.867835 no
7d_25C 7d_30C 0.983077 no
7d_25C 10d_25C 0.181277 no
7d_15C 7d_30C 0.844915 no
7d_15C 10d_25C 0.350455 no
7d_30C 10d_25C 0.162289 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g1657.t1
MANKIDQASTNYKEAFSLFDRRGTGRVAGDLLGDLLRACGQNPTLAEISDLEKSVGGDFDFDSFLKVLNRPGGFR
EPGEPEEYCRGFQVFDKDMTGFIGVGQLRYILTNLGEKMSDDEVDELLKAVDTSSGEINYTDLVRTILAN*
Coding >Pro_DTO377G3_2|g1657.t1
ATGGCTAATAAAATCGATCAGGCATCCACAAACTACAAGGAAGCGTTCTCGCTGTTCGATCGCCGTGGCACTGGC
CGTGTCGCTGGTGACCTCCTCGGTGACCTGCTCCGCGCTTGCGGGCAGAATCCTACGCTGGCTGAGATTAGCGAC
TTGGAGAAGTCCGTTGGCGGCGACTTTGATTTCGACTCGTTCCTGAAAGTCCTCAACCGCCCTGGCGGTTTCCGT
GAGCCCGGCGAGCCGGAGGAGTACTGTCGTGGATTCCAGGTCTTTGATAAGGATATGACCGGGTTTATTGGTGTC
GGACAGTTGCGATACATTCTCACAAATCTTGGCGAGAAGATGTCTGACGATGAAGTCGATGAGCTGCTCAAGGCT
GTTGACACTAGCTCGGGCGAGATTAACTACACGGATCTTGTTCGTACTATCCTCGCCAACTAA
Transcript >Pro_DTO377G3_2|g1657.t1
ATGGCTAATAAAATCGATCAGGCATCCACAAACTACAAGGAAGCGTTCTCGCTGTTCGATCGCCGTGGCACTGGC
CGTGTCGCTGGTGACCTCCTCGGTGACCTGCTCCGCGCTTGCGGGCAGAATCCTACGCTGGCTGAGATTAGCGAC
TTGGAGAAGTCCGTTGGCGGCGACTTTGATTTCGACTCGTTCCTGAAAGTCCTCAACCGCCCTGGCGGTTTCCGT
GAGCCCGGCGAGCCGGAGGAGTACTGTCGTGGATTCCAGGTCTTTGATAAGGATATGACCGGGTTTATTGGTGTC
GGACAGTTGCGATACATTCTCACAAATCTTGGCGAGAAGATGTCTGACGATGAAGTCGATGAGCTGCTCAAGGCT
GTTGACACTAGCTCGGGCGAGATTAACTACACGGATCTTGTTCGTACTATCCTCGCCAACTAA
Gene >Pro_DTO377G3_2|g1657.t1
ATGGCTAATAAAATCGATCAGGCATCCACAAACTACAAGGAAGCGTTCTCGCTGTTCGATCGCCGTGGCACTGGC
CGTGTCGCTGGTGACCTCCTCGGTGACCTGCTCCGCGCTTGCGGGCAGAATCCTACGCTGGCTGAGATTAGCGAC
TTGGAGAAGTCCGTTGGCGGCGACTGTATGTTTTTATTCTTTGATTTATGTATTAGTTGGACGCGATCGCGTCTG
ACTATGAAAAAGGAATTCCTGGCTAACTCTCTCGTTCGCTGCAGTTGATTTCGACTCGTTCCTGAAAGTCCTCAA
CCGCCCTGGCGGTTTCCGTGAGCCCGGCGAGCCGGAGGAGTACTGTCGTGGATTCCAGGTCTTTGATAAGGATAT
GACCGGGTTTATTGGTGTCGGACAGTTGCGATACAGTATGTTTTCTGTTTTTGTCCCAGGCAATTCGGTTTGGTT
GGTCGAAAGGATATTGCTGACATTCCACGCTTGCAGTTCTCACAAATCTTGGCGAGAAGATGTCTGACGATGAAG
TCGATGAGCTGCTCAAGGCTGTTGACACTAGCTCGGGCGAGATTAACTACACGGGTATGTTTCGCTGCGCCTAGA
GTGGGCTATGTGCTATATTGCATCTGCTAACTCTCTCCAGATCTTGTTCGTACTATCCTCGCCAACTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail