Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g1652.t1
Gene name
Locationscaffold_02:525008..525844
Strand-
Gene length (bp)836
Transcript length (bp)687
Coding sequence length (bp)687
Protein length (aa) 229

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10681 Rot1 Chaperone for protein-folding within the ER, fungal 4.0E-89 19 225

GO

GO Term Description Terminal node
GO:0006458 'de novo' protein folding Yes
GO:0005783 endoplasmic reticulum Yes
GO:0008150 biological_process No
GO:0043227 membrane-bounded organelle No
GO:0009987 cellular process No
GO:0043231 intracellular membrane-bounded organelle No
GO:0043226 organelle No
GO:0006457 protein folding No
GO:0110165 cellular anatomical entity No
GO:0043229 intracellular organelle No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g1652.t1
MFLIWSLLVTAALASAGDLFGTWTTKSRDVLTGPGFYDPLNDKLIEPNLTGISYSFDDEGNYESAYYRAISNPAD
PSCPGGVMQWQHGAYTVFGNGTLILTPIAVDGRQLLSNPCRKQAGQYTRYNITEEFQEFSVDIDKFNRIKRLDLT
RMDGSLVHPMFLAYQPPKMLPTTTLNPIPTGHKQKQKRELSSKAGFQLIAREQLINPDRWWWLGVLMTSLGGVAF
FCS*
Coding >Pro_DTO377G3_2|g1652.t1
ATGTTTTTGATTTGGAGTCTTCTAGTCACAGCCGCTTTGGCGAGTGCAGGTGATTTGTTTGGAACGTGGACTACC
AAATCTCGTGATGTTCTTACTGGTCCAGGATTCTACGATCCACTCAACGACAAACTGATCGAGCCGAATCTAACA
GGCATTTCATACTCATTCGATGATGAAGGAAATTACGAATCCGCATACTATCGCGCAATCTCAAACCCGGCTGAC
CCATCATGCCCGGGGGGAGTCATGCAATGGCAACATGGTGCTTATACTGTGTTCGGCAACGGAACGCTGATATTG
ACACCAATTGCTGTCGATGGTCGTCAGCTACTGTCCAATCCCTGCCGGAAGCAGGCAGGCCAGTACACACGATAT
AACATCACCGAGGAGTTTCAGGAATTCTCCGTGGACATCGACAAGTTCAATCGCATTAAACGCCTCGATTTGACC
AGGATGGACGGCTCACTTGTCCATCCCATGTTCCTCGCCTACCAGCCACCAAAGATGCTCCCTACCACGACATTG
AATCCCATACCAACCGGGCATAAGCAAAAGCAAAAGCGAGAACTCTCGTCAAAGGCAGGATTTCAGCTGATCGCT
AGAGAACAGCTGATCAATCCAGACCGATGGTGGTGGTTGGGTGTTCTGATGACTTCTCTTGGAGGAGTAGCTTTC
TTCTGTTCATAA
Transcript >Pro_DTO377G3_2|g1652.t1
ATGTTTTTGATTTGGAGTCTTCTAGTCACAGCCGCTTTGGCGAGTGCAGGTGATTTGTTTGGAACGTGGACTACC
AAATCTCGTGATGTTCTTACTGGTCCAGGATTCTACGATCCACTCAACGACAAACTGATCGAGCCGAATCTAACA
GGCATTTCATACTCATTCGATGATGAAGGAAATTACGAATCCGCATACTATCGCGCAATCTCAAACCCGGCTGAC
CCATCATGCCCGGGGGGAGTCATGCAATGGCAACATGGTGCTTATACTGTGTTCGGCAACGGAACGCTGATATTG
ACACCAATTGCTGTCGATGGTCGTCAGCTACTGTCCAATCCCTGCCGGAAGCAGGCAGGCCAGTACACACGATAT
AACATCACCGAGGAGTTTCAGGAATTCTCCGTGGACATCGACAAGTTCAATCGCATTAAACGCCTCGATTTGACC
AGGATGGACGGCTCACTTGTCCATCCCATGTTCCTCGCCTACCAGCCACCAAAGATGCTCCCTACCACGACATTG
AATCCCATACCAACCGGGCATAAGCAAAAGCAAAAGCGAGAACTCTCGTCAAAGGCAGGATTTCAGCTGATCGCT
AGAGAACAGCTGATCAATCCAGACCGATGGTGGTGGTTGGGTGTTCTGATGACTTCTCTTGGAGGAGTAGCTTTC
TTCTGTTCATAA
Gene >Pro_DTO377G3_2|g1652.t1
ATGTTTTTGATTTGGAGTCTTCTAGTCACAGCCGCTTTGGCGAGTGCAGGTGATTTGTTTGGAACGTGGACTACC
AAATCTCGTGATGTTCTTACTGGTCCAGTATGTGGAACTATGTACACTATATGAATGACTCGAGACTAACGCGCA
TAGGGATTCTACGATCCACTCAACGACAAACTGATCGAGCCGAATCTAACAGGCATTTCATACTCATTCGATGAT
GAAGGAAATTACGAATCCGCATACTATCGCGCAATCTCAAACCGTCAGTTCTCCATGGATCTAGACTTTGGACGC
TGTATTAATATCGAACAGCGGCTGACCCATCATGCCCGGGGGGAGTCATGCAATGGCAACATGGTGCTTATACTG
TGTTCGGCAACGGAACGCTGATATTGACACCAATTGCTGTCGATGGTCGTCAGCTACTGTCCAATCCCTGCCGGA
AGCAGGCAGGCCAGTACACACGATATAACATCACCGAGGAGTTTCAGGTACATTTCTTTCGTGTTCTCTTAGACG
GCTTATCTGACATAAGACAGGAATTCTCCGTGGACATCGACAAGTTCAATCGCATTAAACGCCTCGATTTGACCA
GGATGGACGGCTCACTTGTCCATCCCATGTTCCTCGCCTACCAGCCACCAAAGATGCTCCCTACCACGACATTGA
ATCCCATACCAACCGGGCATAAGCAAAAGCAAAAGCGAGAACTCTCGTCAAAGGCAGGATTTCAGCTGATCGCTA
GAGAACAGCTGATCAATCCAGACCGATGGTGGTGGTTGGGTGTTCTGATGACTTCTCTTGGAGGAGTAGCTTTCT
TCTGTTCATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail