Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g1647.t1
Gene name
Locationscaffold_02:514619..516006
Strand+
Gene length (bp)1387
Transcript length (bp)1314
Coding sequence length (bp)1314
Protein length (aa) 438

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09668 Asp_protease Aspartyl protease 1.4E-60 187 310
PF13975 gag-asp_proteas gag-polyprotein putative aspartyl protease 1.1E-20 213 304
PF13650 Asp_protease_2 Aspartyl protease 7.5E-10 213 300
PF00240 ubiquitin Ubiquitin family 1.5E-08 14 80
PF00627 UBA UBA/TS-N domain 3.1E-05 402 435

GO

GO Term Description Terminal node
GO:0006508 proteolysis Yes
GO:0004190 aspartic-type endopeptidase activity Yes
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003824 catalytic activity No
GO:0008233 peptidase activity No
GO:0140096 catalytic activity, acting on a protein No
GO:0070001 aspartic-type peptidase activity No
GO:0019538 protein metabolic process No
GO:0008150 biological_process No
GO:0071704 organic substance metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0008152 metabolic process No
GO:0044238 primary metabolic process No
GO:0003674 molecular_function No
GO:0006807 nitrogen compound metabolic process No
GO:0004175 endopeptidase activity No
GO:0016787 hydrolase activity No
GO:1901564 organonitrogen compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 85.10 51.70 118.50
5d_25C Five days - 25 degrees Celsius 70.00 42.35 97.65
7d_25C Seven days - 25 degrees Celsius 63.65 38.12 89.18
10d_25C Ten days - 25 degrees Celsius 62.56 37.51 87.61
7d_15C Seven days - 15 degrees Celsius 84.30 51.56 117.05
7d_30C Seven days - 30 degrees Celsius 58.25 34.73 81.77

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.439350 no
3d_25C 7d_25C 0.216893 no
3d_25C 7d_15C 0.979636 no
3d_25C 7d_30C 0.088157 no
3d_25C 10d_25C 0.183464 no
5d_25C 7d_25C 0.752350 no
5d_25C 7d_15C 0.453151 no
5d_25C 7d_30C 0.471672 no
5d_25C 10d_25C 0.701759 no
7d_25C 7d_15C 0.224884 no
7d_25C 7d_30C 0.773957 no
7d_25C 10d_25C 0.961883 no
7d_15C 7d_30C 0.088157 no
7d_15C 10d_25C 0.185265 no
7d_30C 10d_25C 0.823284 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g1647.t1
MRITVNVIRPEQADSDIINLEVGGDMSVELLKAIVESETTIPPEAQQLVYNNQLLQNPSQTLDQAGITEGDMLGV
HVTLRAPQPSTRPAASSSVAPRQNTQPRPGMPDPETIRLHILGDPRVREAVRRQNPELSEAADNAQRFREVLLRQ
QQGEAQREAEKEARIAMLNADPFNHDNQKEIEEIIRQNAVTENLHNAMEHHPESFGRVTMLYIPVEVNGHRLNAF
VDSGAQVTIMSPECATSCNIMRLVDRRYGGIAKGVGTAPILGRVHSAQIKIGEMFLPCSFTVMEGKQIDLLLGLD
MLRRHQACIDLQRGALVIQDQAVPFLGEGDIPKHLTEEFEAEPTVKGADGAEVGARTGAVTHKAENNPNANATSN
ASGSGSGASGSQPRINIRPAPASRWPQDSVARITELGFSREEAVRALDMAHGDLEGAIGFLI*
Coding >Pro_DTO377G3_2|g1647.t1
ATGCGTATCACCGTCAACGTCATCCGCCCCGAGCAGGCGGACTCGGACATCATCAACCTAGAAGTGGGCGGCGAT
ATGTCAGTCGAGCTCCTCAAAGCTATTGTCGAAAGCGAAACTACCATCCCACCCGAAGCGCAGCAGCTCGTCTAC
AACAACCAGCTCCTCCAGAACCCTTCTCAAACCCTAGACCAAGCCGGCATCACCGAGGGCGACATGCTCGGTGTG
CACGTCACCCTCCGAGCTCCCCAGCCCTCCACTCGCCCCGCCGCTTCCAGCTCCGTCGCGCCCAGACAGAACACT
CAACCCCGCCCCGGCATGCCGGACCCCGAAACGATTCGCCTACACATTCTGGGTGATCCCCGCGTGCGCGAGGCC
GTGCGCAGGCAGAACCCGGAGCTGTCTGAGGCCGCGGATAATGCTCAGCGCTTCCGCGAGGTCCTGCTTAGGCAG
CAACAGGGCGAGGCGCAGCGGGAGGCGGAGAAGGAAGCTCGCATTGCGATGCTCAATGCCGATCCTTTTAATCAC
GATAACCAGAAGGAAATTGAGGAAATTATTCGCCAGAATGCTGTTACGGAAAATCTACACAATGCCATGGAGCAT
CATCCTGAGTCCTTCGGTCGCGTGACAATGCTCTACATTCCCGTGGAAGTAAACGGCCACCGTCTAAACGCCTTC
GTCGACTCCGGTGCTCAGGTGACCATCATGTCTCCCGAGTGTGCAACATCGTGTAACATAATGCGCCTGGTAGAC
CGTCGCTATGGCGGCATTGCGAAGGGCGTCGGGACTGCCCCGATCCTGGGCCGGGTTCACTCCGCCCAGATCAAG
ATCGGCGAGATGTTCCTGCCCTGCTCCTTCACCGTCATGGAAGGCAAGCAGATCGACTTGCTCCTGGGGCTGGAC
ATGCTCCGCCGCCACCAGGCCTGCATTGATCTCCAGCGGGGTGCTCTCGTTATCCAAGACCAAGCCGTCCCCTTC
CTCGGGGAGGGCGATATTCCCAAGCACTTGACTGAAGAGTTCGAGGCCGAACCTACGGTCAAGGGAGCCGATGGT
GCCGAAGTGGGTGCCCGCACTGGCGCGGTCACGCACAAAGCGGAGAACAATCCCAATGCCAATGCGACTTCCAAT
GCATCCGGGTCTGGGTCCGGCGCGTCAGGGTCACAGCCCCGAATCAATATCCGGCCTGCGCCTGCTTCGCGGTGG
CCGCAGGATTCCGTTGCCAGGATCACCGAGCTGGGATTCTCGCGCGAGGAAGCCGTCCGGGCTCTTGATATGGCA
CATGGAGACTTGGAAGGGGCGATCGGGTTTTTGATTTGA
Transcript >Pro_DTO377G3_2|g1647.t1
ATGCGTATCACCGTCAACGTCATCCGCCCCGAGCAGGCGGACTCGGACATCATCAACCTAGAAGTGGGCGGCGAT
ATGTCAGTCGAGCTCCTCAAAGCTATTGTCGAAAGCGAAACTACCATCCCACCCGAAGCGCAGCAGCTCGTCTAC
AACAACCAGCTCCTCCAGAACCCTTCTCAAACCCTAGACCAAGCCGGCATCACCGAGGGCGACATGCTCGGTGTG
CACGTCACCCTCCGAGCTCCCCAGCCCTCCACTCGCCCCGCCGCTTCCAGCTCCGTCGCGCCCAGACAGAACACT
CAACCCCGCCCCGGCATGCCGGACCCCGAAACGATTCGCCTACACATTCTGGGTGATCCCCGCGTGCGCGAGGCC
GTGCGCAGGCAGAACCCGGAGCTGTCTGAGGCCGCGGATAATGCTCAGCGCTTCCGCGAGGTCCTGCTTAGGCAG
CAACAGGGCGAGGCGCAGCGGGAGGCGGAGAAGGAAGCTCGCATTGCGATGCTCAATGCCGATCCTTTTAATCAC
GATAACCAGAAGGAAATTGAGGAAATTATTCGCCAGAATGCTGTTACGGAAAATCTACACAATGCCATGGAGCAT
CATCCTGAGTCCTTCGGTCGCGTGACAATGCTCTACATTCCCGTGGAAGTAAACGGCCACCGTCTAAACGCCTTC
GTCGACTCCGGTGCTCAGGTGACCATCATGTCTCCCGAGTGTGCAACATCGTGTAACATAATGCGCCTGGTAGAC
CGTCGCTATGGCGGCATTGCGAAGGGCGTCGGGACTGCCCCGATCCTGGGCCGGGTTCACTCCGCCCAGATCAAG
ATCGGCGAGATGTTCCTGCCCTGCTCCTTCACCGTCATGGAAGGCAAGCAGATCGACTTGCTCCTGGGGCTGGAC
ATGCTCCGCCGCCACCAGGCCTGCATTGATCTCCAGCGGGGTGCTCTCGTTATCCAAGACCAAGCCGTCCCCTTC
CTCGGGGAGGGCGATATTCCCAAGCACTTGACTGAAGAGTTCGAGGCCGAACCTACGGTCAAGGGAGCCGATGGT
GCCGAAGTGGGTGCCCGCACTGGCGCGGTCACGCACAAAGCGGAGAACAATCCCAATGCCAATGCGACTTCCAAT
GCATCCGGGTCTGGGTCCGGCGCGTCAGGGTCACAGCCCCGAATCAATATCCGGCCTGCGCCTGCTTCGCGGTGG
CCGCAGGATTCCGTTGCCAGGATCACCGAGCTGGGATTCTCGCGCGAGGAAGCCGTCCGGGCTCTTGATATGGCA
CATGGAGACTTGGAAGGGGCGATCGGGTTTTTGATTTGA
Gene >Pro_DTO377G3_2|g1647.t1
ATGCGTATCACCGTCAACGTCATCCGCCCCGAGCAGGCGGACTCGGACATCATCAACCTAGAAGTGGGCGGCGAT
ATGTCAGTCGAGCTCCTCAAAGCTATTGTCGAAAGCGAAACTACCATCCCACCCGAAGCGCAGCAGCTCGTCTAC
AACAACCAGCTCCTCCAGAACCCTTCTCAAACCCTAGACCAAGCCGGCATCACCGAGGGCGACATGCTCGGTGTG
CACGTCACCCTCCGAGCTCCCCAGCCCTCCACTCGCCCCGCCGCTTCCAGCTCCGTCGCGCCCAGACAGAACACT
CAACCCCGCCCCGGCATGCCGGACCCCGAAACGATTCGCCTACACATTCTGGGTGATCCCCGCGTGCGCGAGGCC
GTGCGCAGGCAGAACCCGGAGCTGTCTGAGGCCGCGGATAATGCTCAGCGCTTCCGCGAGGTCCTGCTTAGGCAG
CAACAGGGCGAGGCGCAGCGGGAGGCGGAGAAGGAAGCTCGCATTGCGATGCTCAATGCCGATCCTTTTAATCAC
GATAACCAGAAGGAAATTGAGGAAATTATTCGCCAGAATGCTGTTACGGAAAATCTACACAATGCCATGGAGCAT
CATCCTGAGTGTACGCTCTACGTCTTTGAACTGCCGGCTAGGCTGCTCAACTGAGAATAAAGCTAACCAATATGT
TTCTCTAGCCTTCGGTCGCGTGACAATGCTCTACATTCCCGTGGAAGTAAACGGCCACCGTCTAAACGCCTTCGT
CGACTCCGGTGCTCAGGTGACCATCATGTCTCCCGAGTGTGCAACATCGTGTAACATAATGCGCCTGGTAGACCG
TCGCTATGGCGGCATTGCGAAGGGCGTCGGGACTGCCCCGATCCTGGGCCGGGTTCACTCCGCCCAGATCAAGAT
CGGCGAGATGTTCCTGCCCTGCTCCTTCACCGTCATGGAAGGCAAGCAGATCGACTTGCTCCTGGGGCTGGACAT
GCTCCGCCGCCACCAGGCCTGCATTGATCTCCAGCGGGGTGCTCTCGTTATCCAAGACCAAGCCGTCCCCTTCCT
CGGGGAGGGCGATATTCCCAAGCACTTGACTGAAGAGTTCGAGGCCGAACCTACGGTCAAGGGAGCCGATGGTGC
CGAAGTGGGTGCCCGCACTGGCGCGGTCACGCACAAAGCGGAGAACAATCCCAATGCCAATGCGACTTCCAATGC
ATCCGGGTCTGGGTCCGGCGCGTCAGGGTCACAGCCCCGAATCAATATCCGGCCTGCGCCTGCTTCGCGGTGGCC
GCAGGATTCCGTTGCCAGGATCACCGAGCTGGGATTCTCGCGCGAGGAAGCCGTCCGGGCTCTTGATATGGCACA
TGGAGACTTGGAAGGGGCGATCGGGTTTTTGATTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail