Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g1644.t1
Gene name
Locationscaffold_02:506172..507824
Strand+
Gene length (bp)1652
Transcript length (bp)1410
Coding sequence length (bp)1410
Protein length (aa) 470

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10355 Ytp1 Protein of unknown function (Ytp1) 3.7E-70 154 393
PF10348 DUF2427 Domain of unknown function (DUF2427) 1.8E-32 28 126

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.5

Transmembrane Domains

Domain # Start End Length
1 7 24 17
2 44 66 22
3 71 88 17
4 103 125 22
5 137 159 22
6 179 201 22
7 274 296 22
8 300 322 22
9 334 353 19
10 368 390 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g1644.t1
MAYLRQSLWTLFVLVASALAHGGHEAVPEGESISQDPIDATLWTHMILMGLAFGLIFPTGMVLGIIRSRWHVPVQ
VVGTVIAVLAYFLGHAHKGRQFDKNLHASVANWLMLLLVAQVVLGVYLKLHLEKAGQARIRWIFVLAHGIVGKAM
PVLSWAQMLFGGIAALGFCRDDHLGQCLAHFIMGSAFIAYGICLTILLLVGQYWLRRTGRSQEFFDSLIIAAWGC
VNTFTEHRWGSAWVHNDLQHTTMGIIWWCAGLLGMWLSRTRSGRPKRNLIPAIVILITGYAMSAHPQQLMISTMV
HTIFGYTLMAAGLTRIIEISFILRDKPALSEPNSFQYLTPFLLYASGFLFMGATEEQMLLLNNAGVTHVAYVLVL
YSIAFILFLFVNILLHLYAVHAWPNSESTNQDGPMYSTLNGNANVNGRARSNSQQIQDAEAFELHGLISDDDEGP
SMGPRKNSDEELGKEEAHR*
Coding >Pro_DTO377G3_2|g1644.t1
ATGGCATATCTCCGTCAGTCCTTATGGACTTTATTTGTATTAGTGGCCTCGGCTCTCGCCCATGGCGGCCACGAG
GCTGTTCCTGAGGGCGAATCTATCTCCCAGGATCCTATCGATGCAACACTATGGACTCATATGATTCTCATGGGT
TTGGCATTTGGCCTAATCTTCCCAACGGGAATGGTTCTCGGAATCATCCGTTCCCGCTGGCACGTCCCCGTCCAA
GTCGTCGGCACCGTCATCGCCGTACTAGCTTACTTCCTCGGCCACGCCCACAAAGGCCGCCAATTCGACAAGAAC
CTGCACGCCTCCGTCGCAAACTGGCTGATGCTATTGCTGGTCGCGCAAGTTGTCCTCGGAGTATATCTCAAACTG
CACCTGGAGAAGGCGGGCCAGGCCCGCATCCGATGGATCTTCGTGCTGGCCCACGGCATCGTCGGCAAGGCCATG
CCCGTCCTCAGCTGGGCGCAAATGCTCTTCGGTGGCATTGCCGCGCTCGGCTTCTGCCGCGATGACCATCTCGGC
CAGTGTCTGGCCCATTTCATTATGGGCTCCGCCTTCATCGCGTACGGTATCTGTTTGACCATCCTCTTGCTGGTC
GGCCAGTATTGGTTGCGCCGGACCGGCCGCAGCCAGGAATTCTTCGATTCCCTCATCATCGCCGCTTGGGGCTGT
GTCAATACTTTTACCGAACACCGCTGGGGTTCCGCTTGGGTGCACAATGACCTCCAGCATACTACTATGGGCATT
ATCTGGTGGTGTGCTGGTCTGCTGGGTATGTGGCTCAGCCGTACTCGCAGCGGACGTCCTAAGCGTAACCTCATT
CCGGCTATTGTCATCTTGATTACCGGATATGCTATGTCGGCGCATCCCCAGCAGCTGATGATCAGTACCATGGTC
CACACTATCTTCGGGTACACCCTGATGGCGGCGGGTCTGACGCGCATTATTGAGATCTCGTTCATTCTGAGGGAT
AAGCCTGCTCTCTCCGAGCCGAACAGCTTCCAATACCTAACTCCTTTCTTGCTATATGCCTCTGGCTTCCTCTTT
ATGGGCGCCACCGAGGAGCAGATGCTCCTGCTAAACAACGCAGGCGTCACCCACGTGGCGTACGTGTTGGTCCTC
TACAGCATTGCCTTCATCCTCTTCCTCTTCGTCAACATCCTGCTCCACCTCTACGCTGTCCACGCCTGGCCCAAC
TCCGAGTCCACCAATCAGGACGGCCCCATGTACTCCACTCTCAACGGGAACGCGAATGTGAATGGCCGTGCACGC
TCAAACTCGCAGCAGATCCAAGATGCCGAGGCATTCGAGCTCCATGGTTTGATTTCCGATGATGATGAGGGCCCT
TCCATGGGACCGCGGAAGAATAGCGATGAGGAACTTGGAAAAGAAGAGGCCCATCGCTGA
Transcript >Pro_DTO377G3_2|g1644.t1
ATGGCATATCTCCGTCAGTCCTTATGGACTTTATTTGTATTAGTGGCCTCGGCTCTCGCCCATGGCGGCCACGAG
GCTGTTCCTGAGGGCGAATCTATCTCCCAGGATCCTATCGATGCAACACTATGGACTCATATGATTCTCATGGGT
TTGGCATTTGGCCTAATCTTCCCAACGGGAATGGTTCTCGGAATCATCCGTTCCCGCTGGCACGTCCCCGTCCAA
GTCGTCGGCACCGTCATCGCCGTACTAGCTTACTTCCTCGGCCACGCCCACAAAGGCCGCCAATTCGACAAGAAC
CTGCACGCCTCCGTCGCAAACTGGCTGATGCTATTGCTGGTCGCGCAAGTTGTCCTCGGAGTATATCTCAAACTG
CACCTGGAGAAGGCGGGCCAGGCCCGCATCCGATGGATCTTCGTGCTGGCCCACGGCATCGTCGGCAAGGCCATG
CCCGTCCTCAGCTGGGCGCAAATGCTCTTCGGTGGCATTGCCGCGCTCGGCTTCTGCCGCGATGACCATCTCGGC
CAGTGTCTGGCCCATTTCATTATGGGCTCCGCCTTCATCGCGTACGGTATCTGTTTGACCATCCTCTTGCTGGTC
GGCCAGTATTGGTTGCGCCGGACCGGCCGCAGCCAGGAATTCTTCGATTCCCTCATCATCGCCGCTTGGGGCTGT
GTCAATACTTTTACCGAACACCGCTGGGGTTCCGCTTGGGTGCACAATGACCTCCAGCATACTACTATGGGCATT
ATCTGGTGGTGTGCTGGTCTGCTGGGTATGTGGCTCAGCCGTACTCGCAGCGGACGTCCTAAGCGTAACCTCATT
CCGGCTATTGTCATCTTGATTACCGGATATGCTATGTCGGCGCATCCCCAGCAGCTGATGATCAGTACCATGGTC
CACACTATCTTCGGGTACACCCTGATGGCGGCGGGTCTGACGCGCATTATTGAGATCTCGTTCATTCTGAGGGAT
AAGCCTGCTCTCTCCGAGCCGAACAGCTTCCAATACCTAACTCCTTTCTTGCTATATGCCTCTGGCTTCCTCTTT
ATGGGCGCCACCGAGGAGCAGATGCTCCTGCTAAACAACGCAGGCGTCACCCACGTGGCGTACGTGTTGGTCCTC
TACAGCATTGCCTTCATCCTCTTCCTCTTCGTCAACATCCTGCTCCACCTCTACGCTGTCCACGCCTGGCCCAAC
TCCGAGTCCACCAATCAGGACGGCCCCATGTACTCCACTCTCAACGGGAACGCGAATGTGAATGGCCGTGCACGC
TCAAACTCGCAGCAGATCCAAGATGCCGAGGCATTCGAGCTCCATGGTTTGATTTCCGATGATGATGAGGGCCCT
TCCATGGGACCGCGGAAGAATAGCGATGAGGAACTTGGAAAAGAAGAGGCCCATCGCTGA
Gene >Pro_DTO377G3_2|g1644.t1
ATGGCATATCTCCGTCAGTCCTTATGGACTTTATTTGTATTAGTGGCCTCGGCTCTCGCCCATGGCGGCCACGAG
GCTGTTCCTGAGGGCGAATCTATCTCCCAGGATCCTATCGTACGTCCTACTACGCCATTCCCCTCGGCAAAAGTT
AACACATGATTCCAGGATGCAACACTATGGACTCATATGATTCTCATGGGTTTGGCATTTGGCCTAATCTTCCCA
ACGGGAATGGTTCTCGGAGTATGTACCGCTTCACTGACCTCTCCGTTTCCTTCCTACCGTCACGTCACGTCCCAT
CTCTAACAAAAGAAAATAGATCATCCGTTCCCGCTGGCACGTCCCCGTCCAAGTCGTCGGCACCGTCATCGCCGT
ACTAGCTTACTTCCTCGGCCACGCCCACAAAGGCCGCCAATTCGACAAGAACCTGCACGCCTCCGTCGCAAACTG
GCTGATGCTATTGCTGGTCGCGCAAGTTGTCCTCGGAGTATATCTCAAACTGCACCTGGAGAAGGCGGGCCAGGC
CCGCATCCGATGGATCTTCGTGCTGGCCCACGGCATCGTCGGCAAGGCCATGCCCGTCCTCAGCTGGGCGCAAAT
GCTCTTCGGTGGCATTGCCGCGCTCGGCTTCTGCCGCGATGACCATCTCGGCCAGTGTCTGGCCCATTTCATTAT
GGGCTCCGCCTTCATCGCGTACGGTATCTGTTTGACCATCCTCTTGCTGGTCGGCCAGTATTGGTTGCGCCGGAC
CGGCCGCAGCCAGGAATTCTTCGATTCCCTCATCATCGCCGCTTGGGGCTGTGTCAATACTTTTACCGAACACCG
CTGGGGTTCCGCTTGGGTGCACAATGACCTCCAGCATACTACTATGGGCATTATCTGGTGGTGTGCTGGTCTGCT
GGGTATGTGGCTCAGCCGTACTCGCAGCGGACGTCCTAAGCGTAACCTCATTCCGGCTATTGTCATCTTGATTAC
CGGATATGCTATGTCGGCGCATCCCCAGCAGCTGATGATCAGTACCATGGTCCACACTATCTTCGGGTACACCCT
GATGGCGGCGGGTCTGACGCGCATTATTGAGATCTCGTTCATTCTGAGGGATAAGCCTGCTCTCTCCGAGCCGAA
CAGCTTCCAATACCTAACTCCTTTCGTATGTATACTCTCCGGTTGATGTGGTATATAGGATGATACTGACTCTTT
TCTCTTTCAGTTGCTATATGCCTCTGGCTTCCTCTTTATGGGCGCCACCGAGGAGCAGATGCTCCTGCTAAACAA
CGCAGGCGTCACCCACGTGGCGTACGTGTTGGTCCTCTACAGCATTGCCTTCATCCTCTTCCTCTGTAAGTTGAT
TCCCTGCTTTCTTCTTCTAGAACAATCACTCATCCTTCCCTTCAGTCGTCAACATCCTGCTCCACCTCTACGCTG
TCCACGCCTGGCCCAACTCCGAGTCCACCAATCAGGACGGCCCCATGTACTCCACTCTCAACGGGAACGCGAATG
TGAATGGCCGTGCACGCTCAAACTCGCAGCAGATCCAAGATGCCGAGGCATTCGAGCTCCATGGTTTGATTTCCG
ATGATGATGAGGGCCCTTCCATGGGACCGCGGAAGAATAGCGATGAGGAACTTGGAAAAGAAGAGGCCCATCGCT
GA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail