Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g1638.t1
Gene name
Locationscaffold_02:485671..487163
Strand+
Gene length (bp)1492
Transcript length (bp)1134
Coding sequence length (bp)1134
Protein length (aa) 378

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00627 UBA UBA/TS-N domain 1.5E-07 154 183
PF00627 UBA UBA/TS-N domain 1.0E-12 333 368
PF09280 XPC-binding XPC-binding domain 8.9E-23 257 312
PF00240 ubiquitin Ubiquitin family 2.6E-20 3 71
PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like 6.1E-07 1 68

GO

GO Term Description Terminal node
GO:0003684 damaged DNA binding Yes
GO:0006289 nucleotide-excision repair Yes
GO:0005515 protein binding Yes
GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process Yes
GO:0006508 proteolysis No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0044238 primary metabolic process No
GO:0009056 catabolic process No
GO:0006950 response to stress No
GO:0033554 cellular response to stress No
GO:0044260 cellular macromolecule metabolic process No
GO:0009057 macromolecule catabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0006281 DNA repair No
GO:0044265 cellular macromolecule catabolic process No
GO:0009987 cellular process No
GO:0071704 organic substance metabolic process No
GO:1901575 organic substance catabolic process No
GO:0044248 cellular catabolic process No
GO:0097159 organic cyclic compound binding No
GO:0051603 proteolysis involved in cellular protein catabolic process No
GO:1901363 heterocyclic compound binding No
GO:0090304 nucleic acid metabolic process No
GO:0046483 heterocycle metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0051716 cellular response to stimulus No
GO:0044237 cellular metabolic process No
GO:0050896 response to stimulus No
GO:0019538 protein metabolic process No
GO:0005488 binding No
GO:0030163 protein catabolic process No
GO:0006259 DNA metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0003676 nucleic acid binding No
GO:0006807 nitrogen compound metabolic process No
GO:0003674 molecular_function No
GO:0043170 macromolecule metabolic process No
GO:0006511 ubiquitin-dependent protein catabolic process No
GO:0008150 biological_process No
GO:0010498 proteasomal protein catabolic process No
GO:0003677 DNA binding No
GO:0043632 modification-dependent macromolecule catabolic process No
GO:0008152 metabolic process No
GO:1901565 organonitrogen compound catabolic process No
GO:0006974 cellular response to DNA damage stimulus No
GO:0019941 modification-dependent protein catabolic process No
GO:0006139 nucleobase-containing compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 50 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g1638.t1
MKLTFKDLKQEKFVIDVEPSETVREVKVKIAQEKGEYEAERMKVIYSGKILQDDKTVESYNIQEKDFLVCLPSKQ
PKAASSAASSQVPSTPAPRAPVSTPAAPPAPHAAIAPPSFAAPATPSPAGAAPAPASGPAFGDPSALTMGSAAEG
AVVQMEAMGFTRTDIDRAMRAAFYNPDRAIEYLLTGIPENIQEQQQQRQASEPAPTGAAPAAPAAPSSDEPHLNL
FEAAAQAGGEGGGRARGAAGAGAAGGEALGSLEFLRNNPHFQQLRQLVQQQPHMLEPILQQVAAGNPQIASIIGQ
NSDQFLQLLGEELEDEEAALPPGAQAISVTEEERDAIERLCGLGFPRDSVIQAYFACDKNEDLAANFLFDQPDED
EQ*
Coding >Pro_DTO377G3_2|g1638.t1
ATGAAGCTCACTTTCAAGGATCTGAAGCAGGAGAAGTTTGTCATCGATGTCGAACCTTCTGAAACTGTTCGCGAG
GTCAAGGTCAAAATCGCCCAAGAGAAAGGCGAATATGAGGCAGAGCGCATGAAGGTCATCTACTCTGGAAAGATC
CTTCAGGATGATAAGACAGTCGAATCTTACAACATCCAAGAAAAGGACTTCCTAGTGTGCTTGCCTTCGAAGCAA
CCCAAGGCCGCCTCATCTGCCGCTTCCTCCCAAGTTCCCTCGACCCCGGCTCCTCGAGCTCCTGTGTCAACGCCT
GCTGCTCCCCCGGCTCCTCATGCTGCCATTGCTCCTCCCTCTTTTGCCGCCCCCGCGACACCTTCCCCGGCCGGT
GCAGCTCCAGCTCCAGCGAGCGGTCCCGCTTTCGGAGACCCTTCCGCTCTCACCATGGGCTCTGCCGCTGAGGGC
GCAGTCGTCCAGATGGAGGCAATGGGATTCACACGTACCGATATCGACCGTGCCATGCGCGCCGCATTCTATAAC
CCCGATCGTGCCATCGAATATCTCCTAACCGGTATTCCCGAAAACATCCAGGAACAGCAACAACAACGACAAGCC
TCAGAGCCAGCCCCTACCGGCGCTGCTCCTGCTGCCCCTGCTGCTCCTTCCAGTGATGAGCCGCACCTCAACCTC
TTCGAAGCTGCCGCTCAGGCCGGTGGTGAAGGTGGTGGCCGAGCTCGCGGTGCTGCTGGTGCCGGTGCCGCTGGT
GGCGAAGCTCTCGGCAGCCTGGAGTTCCTCCGCAACAACCCCCATTTCCAACAGCTTCGTCAGCTTGTCCAGCAG
CAGCCTCATATGCTCGAGCCCATCCTCCAACAGGTCGCCGCTGGGAATCCTCAAATTGCGTCAATCATCGGACAG
AACTCCGATCAATTCCTGCAGCTTCTAGGTGAGGAACTCGAGGACGAGGAGGCTGCCTTGCCACCCGGCGCGCAG
GCCATTTCAGTTACGGAAGAAGAGCGCGATGCTATTGAACGTCTATGCGGTCTGGGCTTCCCTCGCGACTCCGTC
ATTCAGGCCTACTTCGCCTGCGACAAGAATGAGGATCTCGCCGCCAACTTCCTCTTCGACCAGCCTGACGAGGAT
GAGCAGTAA
Transcript >Pro_DTO377G3_2|g1638.t1
ATGAAGCTCACTTTCAAGGATCTGAAGCAGGAGAAGTTTGTCATCGATGTCGAACCTTCTGAAACTGTTCGCGAG
GTCAAGGTCAAAATCGCCCAAGAGAAAGGCGAATATGAGGCAGAGCGCATGAAGGTCATCTACTCTGGAAAGATC
CTTCAGGATGATAAGACAGTCGAATCTTACAACATCCAAGAAAAGGACTTCCTAGTGTGCTTGCCTTCGAAGCAA
CCCAAGGCCGCCTCATCTGCCGCTTCCTCCCAAGTTCCCTCGACCCCGGCTCCTCGAGCTCCTGTGTCAACGCCT
GCTGCTCCCCCGGCTCCTCATGCTGCCATTGCTCCTCCCTCTTTTGCCGCCCCCGCGACACCTTCCCCGGCCGGT
GCAGCTCCAGCTCCAGCGAGCGGTCCCGCTTTCGGAGACCCTTCCGCTCTCACCATGGGCTCTGCCGCTGAGGGC
GCAGTCGTCCAGATGGAGGCAATGGGATTCACACGTACCGATATCGACCGTGCCATGCGCGCCGCATTCTATAAC
CCCGATCGTGCCATCGAATATCTCCTAACCGGTATTCCCGAAAACATCCAGGAACAGCAACAACAACGACAAGCC
TCAGAGCCAGCCCCTACCGGCGCTGCTCCTGCTGCCCCTGCTGCTCCTTCCAGTGATGAGCCGCACCTCAACCTC
TTCGAAGCTGCCGCTCAGGCCGGTGGTGAAGGTGGTGGCCGAGCTCGCGGTGCTGCTGGTGCCGGTGCCGCTGGT
GGCGAAGCTCTCGGCAGCCTGGAGTTCCTCCGCAACAACCCCCATTTCCAACAGCTTCGTCAGCTTGTCCAGCAG
CAGCCTCATATGCTCGAGCCCATCCTCCAACAGGTCGCCGCTGGGAATCCTCAAATTGCGTCAATCATCGGACAG
AACTCCGATCAATTCCTGCAGCTTCTAGGTGAGGAACTCGAGGACGAGGAGGCTGCCTTGCCACCCGGCGCGCAG
GCCATTTCAGTTACGGAAGAAGAGCGCGATGCTATTGAACGTCTATGCGGTCTGGGCTTCCCTCGCGACTCCGTC
ATTCAGGCCTACTTCGCCTGCGACAAGAATGAGGATCTCGCCGCCAACTTCCTCTTCGACCAGCCTGACGAGGAT
GAGCAGTAA
Gene >Pro_DTO377G3_2|g1638.t1
ATGAAGCTCACTTTCAAGGTACGAAAACTTGCTCTTGGGGTCCTCACTGCTGCAGACTGCTGACAGTCATCGATT
ACAGGATCTGAAGCAGGAGAAGTTTGTCATCGATGTCGAACCTTCTGAAACTGTACGTGTGTTCCTGTCGCTATA
ACTACCCATCGTCATCTAGTGCGGGGCTCATCTGTTTAGGTTCGCGAGGTCAAGGTCAAAATCGCCCAAGAGAAA
GGCGAATATGAGGCAGAGCGCATGAAGGTCATCTACTCTGGTTCGTATTTTCCCCCTTGCTAGACGGATTCTCCG
TTCACGGTGCTATGGCTAACCTTCGCTTTGTTCCCTTTATAGGAAAGATCCTTCAGGATGATAAGACAGTCGAAT
CTTACAACATCCAAGAAAAGGACTTCCTAGTGTGCTTGCCTTCGAAGGTATAGGTTAACCTGGTCTATGATTTCC
GAGCCAGAGCTGACATTTGATGTAGCAACCCAAGGCCGCCTCATCTGCCGCTTCCTCCCAAGTTCCCTCGACCCC
GGCTCCTCGAGCTCCTGTGTCAACGCCTGCTGCTCCCCCGGCTCCTCATGCTGCCATTGCTCCTCCCTCTTTTGC
CGCCCCCGCGACACCTTCCCCGGCCGGTGCAGCTCCAGCTCCAGCGAGCGGTCCCGCTTTCGGAGACCCTTCCGC
TCTCACCATGGGCTCTGCCGCTGAGGGCGCAGTCGTCCAGATGGAGGCAATGGGATTCACACGTACCGATATCGA
CCGTGCCATGCGCGCCGCATTCTATAACCCCGATCGTGCCATCGAATATCTCCTAACCGTAAGCTTTTGTTGGAA
GTTACTTCTTGAATGTTTGCTAATGATCACGACAGGGTATTCCCGAAAACATCCAGGAACAGCAACAACAACGAC
AAGCCTCAGAGCCAGCCCCTACCGGCGCTGCTCCTGCTGCCCCTGCTGCTCCTTCCAGTGATGAGCCGCACCTCA
ACCTCTTCGAAGCTGCCGCTCAGGCCGGTGGTGAAGGTGGTGGCCGAGCTCGCGGTGCTGCTGGTGCCGGTGCCG
CTGGTGGCGAAGCTCTCGGCAGCCTGGAGTTCCTCCGCAACAACCCCCATTTCCAACAGCTTCGTCAGCTTGTCC
AGCAGCAGCCTCATATGCTCGAGCCCATCCTCCAACAGGTCGCCGCTGGGAATCCTCAAATTGCGTCAATCATCG
GACAGAACTCCGATCAATTCCTGCAGCTTCTAGGTGAGGAACTCGAGGACGAGGAGGCTGCCTTGCCACCCGGCG
CGCAGGCCATTTCAGTTACGGAAGAAGAGCGCGATGCTATTGAACGTGTATGTTGAAACTTCCCCTCGATCTCAT
AGTTTTATGACTAACCCACAACCAGCTATGCGGTCTGGGCTTCCCTCGCGACTCCGTCATTCAGGCCTACTTCGC
CTGCGACAAGAATGAGGATCTCGCCGCCAACTTCCTCTTCGACCAGCCTGACGAGGATGAGCAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail