Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g1613.t1
Gene name
Locationscaffold_02:407891..408335
Strand-
Gene length (bp)444
Transcript length (bp)306
Coding sequence length (bp)306
Protein length (aa) 102

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06645 SPC12 Microsomal signal peptidase 12 kDa subunit (SPC12) 3.7E-28 16 85

GO

GO Term Description Terminal node
GO:0005787 signal peptidase complex Yes
GO:0006465 signal peptide processing Yes
GO:0016021 integral component of membrane Yes
GO:0032991 protein-containing complex No
GO:0016485 protein processing No
GO:0043170 macromolecule metabolic process No
GO:0006518 peptide metabolic process No
GO:0043603 cellular amide metabolic process No
GO:0051604 protein maturation No
GO:0019538 protein metabolic process No
GO:1905368 peptidase complex No
GO:0008150 biological_process No
GO:0071704 organic substance metabolic process No
GO:0005575 cellular_component No
GO:0008152 metabolic process No
GO:1902494 catalytic complex No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0140534 endoplasmic reticulum protein-containing complex No
GO:0006807 nitrogen compound metabolic process No
GO:0006508 proteolysis No
GO:0031224 intrinsic component of membrane No
GO:0110165 cellular anatomical entity No
GO:0098796 membrane protein complex No
GO:0044237 cellular metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0009987 cellular process No
GO:0044238 primary metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 26 0.5

Transmembrane Domains

Domain # Start End Length
1 24 46 22
2 51 73 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 214.06 104.94 323.18
5d_25C Five days - 25 degrees Celsius 184.28 85.55 283.00
7d_25C Seven days - 25 degrees Celsius 167.62 77.08 258.17
10d_25C Ten days - 25 degrees Celsius 177.59 82.87 272.32
7d_15C Seven days - 15 degrees Celsius 218.54 105.84 331.23
7d_30C Seven days - 30 degrees Celsius 161.80 72.08 251.53

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.685040 no
3d_25C 7d_25C 0.454047 no
3d_25C 7d_15C 0.964042 no
3d_25C 7d_30C 0.394386 no
3d_25C 10d_25C 0.600536 no
5d_25C 7d_25C 0.823457 no
5d_25C 7d_15C 0.648161 no
5d_25C 7d_30C 0.755471 no
5d_25C 10d_25C 0.938959 no
7d_25C 7d_15C 0.427712 no
7d_25C 7d_30C 0.943522 no
7d_25C 10d_25C 0.902100 no
7d_15C 7d_30C 0.375658 no
7d_15C 10d_25C 0.565616 no
7d_30C 10d_25C 0.832013 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g1613.t1
MDELLAPIQDAIEGQIDFHGQRLADLLSTILLVISGAASFLVGYIYKDIHLTLWTGLAGTLFTAFVVVPPWPVYN
RNPEKWLGSTSARATPGITVDGVKVQ*
Coding >Pro_DTO377G3_2|g1613.t1
ATGGATGAATTACTCGCCCCTATTCAAGATGCCATTGAAGGCCAAATCGACTTCCACGGCCAACGTCTAGCAGAC
CTACTGTCGACCATCTTGCTGGTTATATCAGGGGCCGCCAGTTTCCTCGTCGGATACATCTACAAAGACATTCAC
CTTACGTTATGGACTGGCTTGGCGGGCACACTGTTCACAGCTTTCGTCGTTGTCCCGCCCTGGCCGGTATACAAC
CGTAACCCAGAGAAGTGGTTGGGTTCAACAAGCGCGAGGGCAACTCCGGGTATAACTGTGGACGGGGTGAAGGTG
CAATAA
Transcript >Pro_DTO377G3_2|g1613.t1
ATGGATGAATTACTCGCCCCTATTCAAGATGCCATTGAAGGCCAAATCGACTTCCACGGCCAACGTCTAGCAGAC
CTACTGTCGACCATCTTGCTGGTTATATCAGGGGCCGCCAGTTTCCTCGTCGGATACATCTACAAAGACATTCAC
CTTACGTTATGGACTGGCTTGGCGGGCACACTGTTCACAGCTTTCGTCGTTGTCCCGCCCTGGCCGGTATACAAC
CGTAACCCAGAGAAGTGGTTGGGTTCAACAAGCGCGAGGGCAACTCCGGGTATAACTGTGGACGGGGTGAAGGTG
CAATAA
Gene >Pro_DTO377G3_2|g1613.t1
ATGGATGAATTACTCGCCCCTATTCAAGATGCCATTGAAGGCCAAATCGTACGCTCCGCCGCACCGCCCCTATTG
CTCTGCGCTTTTGGACCATCGAAGCTAACAAGATCTTGATAACAGGACTTCCACGGCCAACGTCTAGCAGACCTA
CTGTCGACCATCTTGCTGGTTATATCAGGGGTATGTTGCACAGATATTGAGTTTTGTATTACCAGAGCGAGCTGA
CGATTGTTTTATCTGCTCCAGGCCGCCAGTTTCCTCGTCGGATACATCTACAAAGACATTCACCTTACGTTATGG
ACTGGCTTGGCGGGCACACTGTTCACAGCTTTCGTCGTTGTCCCGCCCTGGCCGGTATACAACCGTAACCCAGAG
AAGTGGTTGGGTTCAACAAGCGCGAGGGCAACTCCGGGTATAACTGTGGACGGGGTGAAGGTGCAATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail