Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g1607.t1
Gene name
Locationscaffold_02:395344..396651
Strand-
Gene length (bp)1307
Transcript length (bp)1134
Coding sequence length (bp)1134
Protein length (aa) 378

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 48 0.45

Transmembrane Domains

Domain # Start End Length
1 66 88 22
2 109 131 22
3 135 157 22
4 164 182 18
5 197 219 22
6 236 253 17
7 273 295 22
8 302 321 19
9 325 347 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g1607.t1
MAEGKKSDDYTVDMNKIDQGKEFEAAPPPTPSPRANPAITNNPAFPVLAYCGSSIMMTVMNKYVLSGLDFNLNFL
LLCIQSLVCIAAIQTCKSMGLITYRDFNSDEAKKWFPITLLLIGMIYTGSKALQFLSIPVYTIFKNLTIILIAYG
EVLWFGGSVTNLTLFSFGLMVVSSLIAAWADIKHAVESTGDTSSKVSTLNAGYVWMLINCLCTSSYVLGMRKRIK
LTNFKDFDTMFYNNLLSIPVLIVLTLLVEDWSSANLARNFPEANREGIFFAMVLSGASSVFISYTSAWCVRTTSS
TTYSMVGALNKLPIAVSGLVFFDAPVTFPSVSAIAVGFVSGIVYAVAKIKQNSKPRTGVLPTPVSASSQSMRDSL
RS*
Coding >Pro_DTO377G3_2|g1607.t1
ATGGCTGAAGGCAAGAAATCCGACGACTACACCGTCGACATGAACAAGATCGATCAAGGGAAGGAGTTCGAGGCT
GCGCCGCCGCCGACTCCCTCGCCGCGCGCCAATCCCGCCATAACCAACAACCCCGCTTTTCCCGTTTTGGCATAC
TGTGGTTCGTCAATTATGATGACCGTGATGAACAAGTATGTTCTGTCGGGCTTGGACTTCAATCTGAACTTCCTC
TTGCTCTGTATCCAGTCTTTGGTCTGCATTGCGGCAATTCAAACATGCAAGTCTATGGGTCTTATCACCTACCGT
GATTTCAACTCCGATGAGGCCAAAAAGTGGTTCCCGATTACGCTCCTGCTGATCGGCATGATCTACACTGGTTCC
AAGGCCCTTCAGTTCCTCTCAATCCCAGTCTACACCATCTTCAAGAACTTGACCATTATCCTGATTGCCTATGGA
GAGGTTCTCTGGTTTGGTGGCTCGGTCACTAACCTTACTCTGTTCTCCTTCGGTCTGATGGTTGTCAGTTCGCTC
ATTGCCGCCTGGGCTGATATCAAGCATGCCGTGGAGAGCACCGGTGACACCTCTAGCAAGGTCTCCACCCTGAAC
GCCGGATACGTCTGGATGTTGATCAACTGCCTGTGCACCTCTTCCTATGTCCTGGGCATGCGCAAGCGCATCAAG
TTGACCAACTTCAAGGATTTCGACACCATGTTCTACAACAACCTCCTTTCTATCCCCGTCTTGATCGTCCTTACC
CTGCTTGTCGAGGACTGGTCATCCGCCAACCTCGCCCGCAACTTCCCCGAGGCCAACCGTGAGGGTATCTTCTTC
GCCATGGTTCTGTCCGGTGCTTCCTCTGTCTTCATCTCTTACACATCCGCATGGTGTGTCCGCACTACCTCCTCC
ACCACATACTCTATGGTTGGCGCTCTCAACAAGCTGCCTATCGCCGTGTCCGGTCTCGTCTTCTTCGATGCGCCA
GTCACCTTCCCCAGTGTTTCCGCCATCGCTGTTGGCTTCGTCAGCGGTATTGTCTACGCCGTGGCCAAGATCAAG
CAAAACTCTAAGCCCCGTACCGGTGTTCTCCCCACTCCAGTCAGTGCCAGCAGCCAGAGCATGAGAGACTCCCTG
CGCTCCTAA
Transcript >Pro_DTO377G3_2|g1607.t1
ATGGCTGAAGGCAAGAAATCCGACGACTACACCGTCGACATGAACAAGATCGATCAAGGGAAGGAGTTCGAGGCT
GCGCCGCCGCCGACTCCCTCGCCGCGCGCCAATCCCGCCATAACCAACAACCCCGCTTTTCCCGTTTTGGCATAC
TGTGGTTCGTCAATTATGATGACCGTGATGAACAAGTATGTTCTGTCGGGCTTGGACTTCAATCTGAACTTCCTC
TTGCTCTGTATCCAGTCTTTGGTCTGCATTGCGGCAATTCAAACATGCAAGTCTATGGGTCTTATCACCTACCGT
GATTTCAACTCCGATGAGGCCAAAAAGTGGTTCCCGATTACGCTCCTGCTGATCGGCATGATCTACACTGGTTCC
AAGGCCCTTCAGTTCCTCTCAATCCCAGTCTACACCATCTTCAAGAACTTGACCATTATCCTGATTGCCTATGGA
GAGGTTCTCTGGTTTGGTGGCTCGGTCACTAACCTTACTCTGTTCTCCTTCGGTCTGATGGTTGTCAGTTCGCTC
ATTGCCGCCTGGGCTGATATCAAGCATGCCGTGGAGAGCACCGGTGACACCTCTAGCAAGGTCTCCACCCTGAAC
GCCGGATACGTCTGGATGTTGATCAACTGCCTGTGCACCTCTTCCTATGTCCTGGGCATGCGCAAGCGCATCAAG
TTGACCAACTTCAAGGATTTCGACACCATGTTCTACAACAACCTCCTTTCTATCCCCGTCTTGATCGTCCTTACC
CTGCTTGTCGAGGACTGGTCATCCGCCAACCTCGCCCGCAACTTCCCCGAGGCCAACCGTGAGGGTATCTTCTTC
GCCATGGTTCTGTCCGGTGCTTCCTCTGTCTTCATCTCTTACACATCCGCATGGTGTGTCCGCACTACCTCCTCC
ACCACATACTCTATGGTTGGCGCTCTCAACAAGCTGCCTATCGCCGTGTCCGGTCTCGTCTTCTTCGATGCGCCA
GTCACCTTCCCCAGTGTTTCCGCCATCGCTGTTGGCTTCGTCAGCGGTATTGTCTACGCCGTGGCCAAGATCAAG
CAAAACTCTAAGCCCCGTACCGGTGTTCTCCCCACTCCAGTCAGTGCCAGCAGCCAGAGCATGAGAGACTCCCTG
CGCTCCTAA
Gene >Pro_DTO377G3_2|g1607.t1
ATGGCTGAAGGCAAGAAATCCGACGACTACACCGTCGACATGAACAAGATCGATCAAGGGAAGGAGTTCGAGGCT
GCGCCGCCGCCGACTCCCTCGCCGCGCGCCAATCCCGCCATAACCAACAACCCCGCTTTTCCCGTTTTGGCATAC
TGTGGTTCGTCAATTATGATGACCGTGATGAACAAGTATGTTCTGTCGGGCTTGGACTTCAATCTGAACTTCCTC
TTGCTCTGTATCCAGGTATGTGGTGGATTGGATCTAGCAGTCTTGATCCGAGGCGAATTGCTAATATCAACAGTC
TTTGGTCTGCATTGCGGCAATTCAAACATGCAAGTCTATGGGTCTTATCACCTACCGTGATTTCAACTCCGATGA
GGCCAAAAAGTGTATGGACTCCGATTATCGCAAGCTAAGAGATATCCCAGCTGACACGATTCCATATTAGGGTTC
CCGATTACGCTCCTGCTGATCGGCATGATCTACACTGGTTCCAAGGCCCTTCAGTTCCTCTCAATCCCAGTCTAC
ACCATCTTCAAGAACTTGACCATTATCCTGATTGCCTATGGAGAGGTTCTCTGGTTTGGTGGCTCGGTCACTAAC
CTTACTCTGTTCTCCTTCGGTCTGATGGTTGTCAGTTCGCTCATTGCCGCCTGGGCTGATATCAAGCATGCCGTG
GAGAGCACCGGTGACACCTCTAGCAAGGTCTCCACCCTGAACGCCGGATACGTCTGGATGTTGATCAACTGCCTG
TGCACCTCTTCCTATGTCCTGGGCATGCGCAAGCGCATCAAGTTGACCAACTTCAAGGATTTCGACAGTATGTGA
TTCTTCTACGCTTGTTTCAATTGTTTGCTAACATGATCTTCTCTCCAGCCATGTTCTACAACAACCTCCTTTCTA
TCCCCGTCTTGATCGTCCTTACCCTGCTTGTCGAGGACTGGTCATCCGCCAACCTCGCCCGCAACTTCCCCGAGG
CCAACCGTGAGGGTATCTTCTTCGCCATGGTTCTGTCCGGTGCTTCCTCTGTCTTCATCTCTTACACATCCGCAT
GGTGTGTCCGCACTACCTCCTCCACCACATACTCTATGGTTGGCGCTCTCAACAAGCTGCCTATCGCCGTGTCCG
GTCTCGTCTTCTTCGATGCGCCAGTCACCTTCCCCAGTGTTTCCGCCATCGCTGTTGGCTTCGTCAGCGGTATTG
TCTACGCCGTGGCCAAGATCAAGCAAAACTCTAAGCCCCGTACCGGTGTTCTCCCCACTCCAGTCAGTGCCAGCA
GCCAGAGCATGAGAGACTCCCTGCGCTCCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail