Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g1600.t1
Gene name
Locationscaffold_02:382053..384446
Strand+
Gene length (bp)2393
Transcript length (bp)1692
Coding sequence length (bp)1692
Protein length (aa) 564

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03464 eRF1_2 eRF1 domain 2 1.9E-45 217 348
PF03465 eRF1_3 eRF1 domain 3 2.8E-30 352 478
PF03463 eRF1_1 eRF1 domain 1 2.4E-21 90 211
PF18854 baeRF_family10 Bacterial archaeo-eukaryotic release factor family 10 3.5E-07 205 327
PF18859 acVLRF1 Actinobacteria/chloroflexi VLRF1 release factor 4.4E-07 218 311

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g1600.t1
MLSCNIYLYIDSTTHATTRQVPNTSRPGGSPGLPQRASRPLEQTCPRIKGVKQASAGPPITLPLINCRLAKMSAP
PPNEAEKNIEIWKVKKLIKRLEAARGNGTSMISLIIPPKDQVSRAAKMLAEEYGTASNIKSRVNRLSVLSAITST
QQRLKLYNKVPPNGLVVYCGEIITSEGKERKINIDFEPFKPINTSLYLCDNKFHTEALSELLEADQKFGFIVMDG
NGTLFGTLSGNTREILQRLTVDLPKKHGRGGQSALRFSRLREEKRHNYVRKIAELAVQNYITNDKPNVAGIVLAG
SADFKNDLNQSDLFDGRLQSKVIKIVDVSYGGENGFNQAIELAGETLSNVKFVQEKKLINQYFQEISQDTGKVCY
GIEDTLKAMELGAAEILIVHENLEITRWVMKNSAGAQVIVHTTKAQEANKDIFQDKETGMDMEVVESGSFLEWLA
EAYKDFGANLEFVSDRSGEGNQFVKGFGATMTSSTMIDGGSRDGTKASVKDNQKRPGPRPVKLLRVSSKLQDTHT
ELASVSEMKKRFKLQFERLGAVICNVWSSTAACTAYSM*
Coding >Pro_DTO377G3_2|g1600.t1
ATGCTATCATGCAATATATACCTATATATAGATAGTACTACACATGCCACAACCCGGCAAGTACCAAATACGTCA
CGCCCTGGGGGTAGCCCTGGCTTACCTCAGCGTGCCAGCCGACCCCTCGAACAAACTTGTCCACGGATTAAAGGT
GTAAAACAGGCGTCTGCAGGGCCTCCGATAACTCTTCCCCTGATCAACTGTCGCCTCGCCAAGATGAGCGCTCCT
CCGCCGAACGAAGCTGAGAAGAATATTGAGATCTGGAAGGTCAAGAAGCTGATCAAGCGTCTTGAAGCCGCTCGT
GGAAATGGAACCTCCATGATTTCGCTCATTATCCCCCCCAAGGATCAGGTTAGCAGAGCAGCCAAGATGTTGGCT
GAAGAGTATGGTACCGCCTCCAACATTAAATCTCGAGTGAACCGACTCTCCGTGCTGTCGGCCATTACGTCTACT
CAGCAGCGTCTGAAGCTCTACAACAAGGTCCCTCCCAATGGACTGGTCGTGTACTGTGGTGAAATTATCACCTCG
GAAGGAAAGGAGCGCAAGATTAACATCGACTTCGAACCTTTCAAGCCCATCAACACATCCCTCTACCTGTGTGAC
AACAAGTTCCACACCGAGGCATTGAGTGAGCTTCTCGAGGCCGATCAGAAGTTCGGTTTCATTGTCATGGACGGT
AACGGTACTTTGTTCGGTACTCTCAGTGGCAACACCCGTGAGATCCTTCAGCGTCTCACCGTTGATCTGCCCAAG
AAGCACGGCCGTGGTGGTCAATCTGCGCTGCGTTTCTCGCGTCTCCGTGAGGAAAAGCGCCACAACTACGTGCGC
AAGATCGCCGAATTGGCTGTTCAGAACTACATCACCAACGACAAGCCCAATGTCGCCGGTATTGTGTTGGCTGGT
TCCGCCGATTTCAAGAACGATCTTAACCAGTCCGACCTGTTCGATGGTCGTCTGCAATCCAAGGTTATCAAGATT
GTCGATGTTTCCTACGGTGGCGAGAACGGTTTCAACCAGGCCATCGAATTGGCTGGCGAGACCCTGAGCAACGTC
AAGTTCGTTCAGGAGAAGAAGCTTATCAACCAGTACTTCCAGGAGATCAGCCAAGACACCGGCAAGGTCTGCTAT
GGTATTGAAGATACCCTCAAGGCAATGGAGCTTGGTGCAGCCGAAATCTTGATCGTCCACGAGAACTTGGAAATC
ACTCGCTGGGTCATGAAGAACTCCGCAGGCGCTCAGGTGATCGTCCACACGACTAAGGCCCAGGAAGCCAACAAG
GATATCTTCCAAGACAAGGAAACCGGAATGGATATGGAGGTTGTCGAGTCAGGCTCTTTCCTCGAATGGCTTGCC
GAGGCCTACAAGGACTTTGGTGCCAACCTGGAGTTCGTGTCTGATCGATCCGGCGAAGGAAACCAGTTCGTCAAG
GGTTTCGGTGCGACGATGACGAGTTCTACGATGATTGACGGCGGCTCCCGCGATGGAACTAAGGCATCCGTGAAG
GATAACCAAAAAAGGCCTGGTCCACGCCCCGTGAAGCTGCTCAGAGTGTCGTCCAAGCTCCAAGATACGCACACT
GAGCTCGCCTCAGTGTCTGAGATGAAGAAGAGGTTTAAATTGCAATTTGAAAGGTTGGGTGCAGTAATCTGCAAC
GTTTGGTCGTCCACCGCTGCTTGCACTGCTTACTCTATGTAA
Transcript >Pro_DTO377G3_2|g1600.t1
ATGCTATCATGCAATATATACCTATATATAGATAGTACTACACATGCCACAACCCGGCAAGTACCAAATACGTCA
CGCCCTGGGGGTAGCCCTGGCTTACCTCAGCGTGCCAGCCGACCCCTCGAACAAACTTGTCCACGGATTAAAGGT
GTAAAACAGGCGTCTGCAGGGCCTCCGATAACTCTTCCCCTGATCAACTGTCGCCTCGCCAAGATGAGCGCTCCT
CCGCCGAACGAAGCTGAGAAGAATATTGAGATCTGGAAGGTCAAGAAGCTGATCAAGCGTCTTGAAGCCGCTCGT
GGAAATGGAACCTCCATGATTTCGCTCATTATCCCCCCCAAGGATCAGGTTAGCAGAGCAGCCAAGATGTTGGCT
GAAGAGTATGGTACCGCCTCCAACATTAAATCTCGAGTGAACCGACTCTCCGTGCTGTCGGCCATTACGTCTACT
CAGCAGCGTCTGAAGCTCTACAACAAGGTCCCTCCCAATGGACTGGTCGTGTACTGTGGTGAAATTATCACCTCG
GAAGGAAAGGAGCGCAAGATTAACATCGACTTCGAACCTTTCAAGCCCATCAACACATCCCTCTACCTGTGTGAC
AACAAGTTCCACACCGAGGCATTGAGTGAGCTTCTCGAGGCCGATCAGAAGTTCGGTTTCATTGTCATGGACGGT
AACGGTACTTTGTTCGGTACTCTCAGTGGCAACACCCGTGAGATCCTTCAGCGTCTCACCGTTGATCTGCCCAAG
AAGCACGGCCGTGGTGGTCAATCTGCGCTGCGTTTCTCGCGTCTCCGTGAGGAAAAGCGCCACAACTACGTGCGC
AAGATCGCCGAATTGGCTGTTCAGAACTACATCACCAACGACAAGCCCAATGTCGCCGGTATTGTGTTGGCTGGT
TCCGCCGATTTCAAGAACGATCTTAACCAGTCCGACCTGTTCGATGGTCGTCTGCAATCCAAGGTTATCAAGATT
GTCGATGTTTCCTACGGTGGCGAGAACGGTTTCAACCAGGCCATCGAATTGGCTGGCGAGACCCTGAGCAACGTC
AAGTTCGTTCAGGAGAAGAAGCTTATCAACCAGTACTTCCAGGAGATCAGCCAAGACACCGGCAAGGTCTGCTAT
GGTATTGAAGATACCCTCAAGGCAATGGAGCTTGGTGCAGCCGAAATCTTGATCGTCCACGAGAACTTGGAAATC
ACTCGCTGGGTCATGAAGAACTCCGCAGGCGCTCAGGTGATCGTCCACACGACTAAGGCCCAGGAAGCCAACAAG
GATATCTTCCAAGACAAGGAAACCGGAATGGATATGGAGGTTGTCGAGTCAGGCTCTTTCCTCGAATGGCTTGCC
GAGGCCTACAAGGACTTTGGTGCCAACCTGGAGTTCGTGTCTGATCGATCCGGCGAAGGAAACCAGTTCGTCAAG
GGTTTCGGTGCGACGATGACGAGTTCTACGATGATTGACGGCGGCTCCCGCGATGGAACTAAGGCATCCGTGAAG
GATAACCAAAAAAGGCCTGGTCCACGCCCCGTGAAGCTGCTCAGAGTGTCGTCCAAGCTCCAAGATACGCACACT
GAGCTCGCCTCAGTGTCTGAGATGAAGAAGAGGTTTAAATTGCAATTTGAAAGGTTGGGTGCAGTAATCTGCAAC
GTTTGGTCGTCCACCGCTGCTTGCACTGCTTACTCTATGTAA
Gene >Pro_DTO377G3_2|g1600.t1
ATGCTATCATGCAATATATACCTATATATAGATAGTACTACACATGTACATAGCCGAAAGTAGCAGAAGGACATG
TATAAAAGAACAATGTACCTGTACCTGATCACCCGGTCTTAGGCCACAACCCGGCAAGTACCAAATACGTCACGC
CCTGGGGGTAGCCCTGGCTTACCTCAGCGTGCCAGCCGACCCCTCGAACAAACTTGTCCACGGATGTATGTCCAA
CCCCACGAGGAAATTTGCTGTCGCTTCTGAACGTCATCTTCAGTAAAGGTATGTACTCTCCGTGGTTGAATCTAT
GAGTATTAAGAAGAAAACACCAATATTCACTTTTCACTCTTTTTTTTTCTTTTTTTTCGCACCTACTAACTGATC
TTAGGTGTAAAACAGGCAAGCCTAAATCTTTGTTCGCCGACTCCCGCCCACTTTACTGACCAAATCTTCAGGCGT
CTGCAGGGCCTCCGATAACTCTTCCCCTGATCAACTGTCGCCTCGCCAAGATGAGCGCTCCTCCGCCGAACGAAG
CTGAGAAGAATATTGAGATCTGGAAGGTCAAGAAGCTGATCAAGCGTCTTGAAGCCGCTCGTGGAAATGGAACCT
CCATGATTTCGCTCATTATCCGTGCGCTGCCCCAACCCCGTCACTTATGGTCGCCGCTAATATGCCAATTCAGCC
CCCAAGGATCAGGTTAGCAGAGCAGCCAAGATGTTGGCTGAAGAGTATGTACGTGAAACCATATCCCTCTGATCT
GTCTGCGCCGACCGTCGCCTAATCGCACAATAGGGTACCGCCTCCAACATTAAATCTCGAGTGAACCGACTCTCC
GTGCTGTCGGCCATTACGTCTACTCAGCAGCGTCTGAAGCTCTACAACAAGGTCCCTCCCAATGGACTGGTCGTG
TACTGTGGTGAAATTATCACCTCGGAAGGAAAGGAGCGCAAGATTAACATCGACTTCGAACCTTTCAAGCCCATC
AACACATCCCTCTACCTGTGTGACAACAAGTTCCACACCGAGGCATTGAGTGAGCTTCTCGAGGCCGATCAGAAG
TTCGGTTTCATTGTCATGGACGGTAACGGTACTTTGTTCGGTACTCTCAGTGGCAACACCCGTGAGATCCTTCAG
CGTCTCACCGTTGATCTGCCCAAGAAGCACGTGAGTGTCCCGACTGATTGATTACGATATTCATCCATACTGATC
CATACAGGGCCGTGGTGGTCAATCTGCGCTGCGTTTCTCGCGTCTCCGTGAGGAAAAGCGCCACAACTACGTGCG
CAAGATCGCCGAATTGGCTGTTCAGAACTACATCACCAACGACAAGCCCAATGTCGCCGGTATTGTGTTGGCTGG
TTCCGCCGATTTCAAGAACGATCTTAACCAGTCCGACCTGTTCGATGGTCGTCTGCAATCCAAGGTTATCAAGAT
TGTCGATGTTTCCTACGGTGGCGAGAACGGTTTCAACCAGGCCATCGAATTGGCTGGCGAGACCCTGAGCAACGT
CAAGTTCGTTCAGGAGAAGAAGCTTATCAACCAGTACTTCCAGGAGATCAGCCAAGACACCGGCAAGGTCTGCTA
TGGTATTGAAGATACCCTCAAGGCAATGGAGCTTGGTGCAGCCGAAATCTTGATCGTCCACGAGAACTTGGAAAT
CACTCGCTGGGTCATGAAGAACTCCGCAGGCGCTCAGGTGATCGTCCACACGACTAAGGCCCAGGAAGCCAACAA
GGATATCTTCCAAGACAAGGAAACCGGAATGGATATGGAGGTTGTCGAGTCAGGCTCTTTCCTCGAATGGCTTGC
CGAGGCCTACAAGGACTTTGGTGCCAACCTGGAGTTCGTGTCTGATCGATCCGGCGAAGGAAACCAGTTCGTCAA
GGGTTTCGGTGGTATCGGTGCCATTCTCCGATACAAGGTCAACTTTGAACAGCTTGCCGATCACAGCGACGATGA
CGAGTTCTACGATGGTATGTTCTTCCAGTTTTCCGTTTTCTATGTGTATGTTAACAAGAACCTCTACAGATTGAC
GGTATTGCCCCCTCGCAGAGAGCGAGGATGAACGGCCAGAAGCTCCCGCGGCGAGTCTTTTGACGGCTCGCCCTG
TGGATCATACAGGCGGCTCCCGCGATGGAACTAAGGCATCCGTGAAGGATAACCAAAAAAGGCCTGGTCCACGCC
CCGTGAAGCTGCTCAGAGGTGAGACATCCAGCTAGGCTATCACCCAGGTTTAGCTCTAATGTTCGTGTACAGTGT
CGTCCAAGCTCCAAGATACGCACACTGAGCTCGCCTCAGTGTCTGAGATGAAGAAGAGGTTTAAATTGCAATTTG
AAAGGTTGGGTGCAGTAATCTGCAACGTTTGGTCGTCCACCGCTGCTTGCACTGCTTACTCTATGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail