Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g160.t1
Gene name
Locationscaffold_01:420887..422063
Strand+
Gene length (bp)1176
Transcript length (bp)1065
Coding sequence length (bp)1065
Protein length (aa) 355

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04177 TAP42 TAP42-like family 2.5E-105 7 344

GO

GO Term Description Terminal node
GO:0009966 regulation of signal transduction Yes
GO:0008150 biological_process No
GO:0050789 regulation of biological process No
GO:0050794 regulation of cellular process No
GO:0023051 regulation of signaling No
GO:0010646 regulation of cell communication No
GO:0048583 regulation of response to stimulus No
GO:0065007 biological regulation No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 40 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g160.t1
MEEPQSLRSLFASAKEQKDALGSRGDTNAETYRDEVNATIAKFQECQRQVSMLSLFSSNELLEDISTGDLQYMTL
EFHLAELLQRVSDSDREAVLKRALEEYEKYLMRLDEYLLLSGGDKKLFEQYMANPTSFTLAPANDAAARREIKVT
RFREEKELKQKLEYFGRNEARLQSDDDDTRSLYLAELQLYTHQTFQALDLLIQELSILSGMRNAPPRPPPTDDPR
QRSNIGGLNYSEKLDPSVSQLLKGGRGGPILNSKGKPMQPFTLLGRRSEMQQGVFRSGHNLPTMTIDEYLEEEHR
RGNVIEGGGEKSGIKPQVDEDDHNIADQETMKARNWDEYTEANPKGAGNTLNRG*
Coding >Pro_DTO377G3_2|g160.t1
ATGGAAGAACCGCAGAGTCTTCGCTCTCTATTTGCATCAGCAAAAGAGCAAAAAGATGCATTGGGATCGCGGGGT
GACACCAACGCTGAGACCTACCGAGACGAGGTGAATGCGACGATAGCCAAATTCCAAGAATGCCAGCGTCAAGTG
AGCATGCTGTCCTTGTTTAGTTCTAATGAGTTGTTGGAAGATATTTCGACCGGTGATCTCCAGTACATGACACTG
GAATTTCATCTAGCTGAGCTCTTGCAGCGAGTTTCTGACTCAGATCGTGAAGCCGTCCTCAAGCGTGCGCTCGAA
GAATATGAGAAATACCTGATGCGTTTGGATGAGTACCTGCTACTCTCTGGCGGGGATAAGAAGCTCTTTGAGCAA
TACATGGCCAATCCGACCTCTTTTACCCTGGCGCCAGCTAACGACGCTGCCGCCAGACGGGAAATTAAAGTGACA
CGGTTTCGGGAAGAAAAAGAACTAAAGCAGAAACTGGAGTATTTCGGACGCAACGAAGCTCGACTGCAAAGCGAC
GACGATGACACCCGATCCCTCTATCTAGCGGAGCTTCAGCTTTACACCCACCAGACCTTCCAGGCATTAGATCTC
CTGATCCAAGAATTGTCGATACTTTCAGGTATGCGCAATGCGCCGCCTCGCCCTCCACCGACGGACGATCCCAGA
CAGCGAAGCAATATTGGAGGTTTGAATTACTCAGAGAAGCTAGATCCTTCAGTGTCACAGCTCTTGAAGGGAGGC
AGAGGCGGTCCTATCCTGAACAGCAAAGGAAAGCCAATGCAGCCGTTCACGTTGTTGGGTCGGCGCTCAGAAATG
CAACAAGGAGTCTTTCGTTCGGGCCATAACCTTCCTACCATGACAATTGATGAATATCTCGAGGAAGAACACAGA
CGAGGAAATGTCATCGAAGGAGGAGGCGAGAAGTCTGGCATCAAACCGCAAGTTGACGAGGATGATCACAACATT
GCCGACCAGGAAACGATGAAGGCACGAAATTGGGACGAGTACACGGAAGCTAATCCGAAGGGTGCTGGAAACACA
CTGAACCGGGGATAA
Transcript >Pro_DTO377G3_2|g160.t1
ATGGAAGAACCGCAGAGTCTTCGCTCTCTATTTGCATCAGCAAAAGAGCAAAAAGATGCATTGGGATCGCGGGGT
GACACCAACGCTGAGACCTACCGAGACGAGGTGAATGCGACGATAGCCAAATTCCAAGAATGCCAGCGTCAAGTG
AGCATGCTGTCCTTGTTTAGTTCTAATGAGTTGTTGGAAGATATTTCGACCGGTGATCTCCAGTACATGACACTG
GAATTTCATCTAGCTGAGCTCTTGCAGCGAGTTTCTGACTCAGATCGTGAAGCCGTCCTCAAGCGTGCGCTCGAA
GAATATGAGAAATACCTGATGCGTTTGGATGAGTACCTGCTACTCTCTGGCGGGGATAAGAAGCTCTTTGAGCAA
TACATGGCCAATCCGACCTCTTTTACCCTGGCGCCAGCTAACGACGCTGCCGCCAGACGGGAAATTAAAGTGACA
CGGTTTCGGGAAGAAAAAGAACTAAAGCAGAAACTGGAGTATTTCGGACGCAACGAAGCTCGACTGCAAAGCGAC
GACGATGACACCCGATCCCTCTATCTAGCGGAGCTTCAGCTTTACACCCACCAGACCTTCCAGGCATTAGATCTC
CTGATCCAAGAATTGTCGATACTTTCAGGTATGCGCAATGCGCCGCCTCGCCCTCCACCGACGGACGATCCCAGA
CAGCGAAGCAATATTGGAGGTTTGAATTACTCAGAGAAGCTAGATCCTTCAGTGTCACAGCTCTTGAAGGGAGGC
AGAGGCGGTCCTATCCTGAACAGCAAAGGAAAGCCAATGCAGCCGTTCACGTTGTTGGGTCGGCGCTCAGAAATG
CAACAAGGAGTCTTTCGTTCGGGCCATAACCTTCCTACCATGACAATTGATGAATATCTCGAGGAAGAACACAGA
CGAGGAAATGTCATCGAAGGAGGAGGCGAGAAGTCTGGCATCAAACCGCAAGTTGACGAGGATGATCACAACATT
GCCGACCAGGAAACGATGAAGGCACGAAATTGGGACGAGTACACGGAAGCTAATCCGAAGGGTGCTGGAAACACA
CTGAACCGGGGATAA
Gene >Pro_DTO377G3_2|g160.t1
ATGGAAGAACCGCAGAGTCTTCGCTCTCTATTTGCATCAGCAAAAGAGCAAAAAGATGCATTGGGATCGCGGGGT
GACACCAACGCTGAGACCTACCGAGACGAGGTGAATGCGACGATAGCCAAATTCCAAGAATGCCAGCGTCAAGTG
AGCATGCTGTCCTTGTTTAGTTCTAATGAGTTGTTGGAAGATATTTCGACCGGTGATCTCCAGTACGCCACCTTG
ATTCCGGCATTGCGTTGCCCATTCGGCTGATTTGTTGTCCAGGTACATGACACTGGAATTTCATCTAGCTGAGCT
CTTGCAGCGAGTTTCTGACTCAGATCGTGAAGCCGTCCTCAAGCGTGCGCTCGAAGAATATGAGAAATACCTGAT
GCGTTTGGATGAGTACCTGCTACTCTCTGGCGGGGATAAGAAGCTCTTTGAGCAATACATGGCCAATCCGACCTC
TTTTACCCTGGCGCCAGCTAACGACGCTGCCGCCAGACGGGAAATTAAAGTGACACGGTTTCGGGAAGAAAAAGA
ACTAAAGCAGAAACTGGAGGTATGCGGGATCCTTTGCTGGATATTGTTTGGCGTTCTTGCTTACCCCATCTAAAG
TATTTCGGACGCAACGAAGCTCGACTGCAAAGCGACGACGATGACACCCGATCCCTCTATCTAGCGGAGCTTCAG
CTTTACACCCACCAGACCTTCCAGGCATTAGATCTCCTGATCCAAGAATTGTCGATACTTTCAGGTATGCGCAAT
GCGCCGCCTCGCCCTCCACCGACGGACGATCCCAGACAGCGAAGCAATATTGGAGGTTTGAATTACTCAGAGAAG
CTAGATCCTTCAGTGTCACAGCTCTTGAAGGGAGGCAGAGGCGGTCCTATCCTGAACAGCAAAGGAAAGCCAATG
CAGCCGTTCACGTTGTTGGGTCGGCGCTCAGAAATGCAACAAGGAGTCTTTCGTTCGGGCCATAACCTTCCTACC
ATGACAATTGATGAATATCTCGAGGAAGAACACAGACGAGGAAATGTCATCGAAGGAGGAGGCGAGAAGTCTGGC
ATCAAACCGCAAGTTGACGAGGATGATCACAACATTGCCGACCAGGAAACGATGAAGGCACGAAATTGGGACGAG
TACACGGAAGCTAATCCGAAGGGTGCTGGAAACACACTGAACCGGGGATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail