Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g1599.t1
Gene name
Locationscaffold_02:379392..381535
Strand-
Gene length (bp)2143
Transcript length (bp)1887
Coding sequence length (bp)1887
Protein length (aa) 629

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01490 Aa_trans Transmembrane amino acid transporter protein 5.4E-69 226 619

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 60 0.45

Transmembrane Domains

Domain # Start End Length
1 233 252 19
2 257 279 22
3 305 327 22
4 337 356 19
5 363 385 22
6 405 427 22
7 447 466 19
8 476 498 22
9 540 559 19
10 563 585 22
11 598 620 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 15.54 8.00 23.09
5d_25C Five days - 25 degrees Celsius 14.04 7.08 21.01
7d_25C Seven days - 25 degrees Celsius 14.23 7.16 21.30
10d_25C Ten days - 25 degrees Celsius 13.61 6.84 20.38
7d_15C Seven days - 15 degrees Celsius 11.11 5.18 17.05
7d_30C Seven days - 30 degrees Celsius 16.85 8.87 24.82

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.792679 no
3d_25C 7d_25C 0.823635 no
3d_25C 7d_15C 0.279305 no
3d_25C 7d_30C 0.832498 no
3d_25C 10d_25C 0.710387 no
5d_25C 7d_25C 0.977250 no
5d_25C 7d_15C 0.492229 no
5d_25C 7d_30C 0.582222 no
5d_25C 10d_25C 0.943021 no
7d_25C 7d_15C 0.466962 no
7d_25C 7d_30C 0.619689 no
7d_25C 10d_25C 0.919664 no
7d_15C 7d_30C 0.147337 no
7d_15C 10d_25C 0.561458 no
7d_30C 10d_25C 0.498957 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g1599.t1
MSRAGTDQDHDSEPVYGSRRIPIATPSSHDHGHLDGSPTAADSETGGRQRSSSYSIRVRQAGGPNSIDNFARSWQ
RAAAFPEVLPRRLSFVSAQPQSDDEFAVATGQAYVPRSFPSWGRHSDVDRPLLQDSDSDQDDGDSRAPGSPRRAL
PSAGLLASSFDRAFATSYGTISSRMSDSTRRNAIQFHREQHPHVHVDGTEDLDAGPLLVKHVQQEDGTQVNIIVG
QSTLPQTIFNSVNVLIGIGLLSLPLAMKHAGWGLGLVFLVFSAVTTSYTAKVLAKCLDVDQTVVTYADLAYISFG
QHARLVTSFLFCLELLGACVALVVLFSDSLYALVPGLSILQWKIVCGVVLLPLNFLPLRFLSITSILGIISCTSI
VILICIDGFIKPDAPGSLRQPAKTFLFPENWATVPLSFGLIMSPWGGHGVFPNIYRDMRHPQKYGKSLRVTYLFT
FILDCSMAIIGWLMFGDGVRDEITANILTVTSYPQALSVCIVVFISIIPLTKVPLNARPLVATMEVLCGLGGGHV
LAENSSGTRQRIARAMVRVFIVAMIVVLAVIFPAFDRIMAFLGSFLCFTICIIFPLAFHLKIFGKEIGRGEYILD
WILLIVSSILAAVGTVFAFLPQDMLSAK*
Coding >Pro_DTO377G3_2|g1599.t1
ATGTCGAGGGCTGGAACAGATCAAGATCACGACAGTGAACCGGTATATGGCTCACGGAGGATACCGATTGCGACA
CCGAGCTCCCACGATCATGGCCATCTAGATGGTAGTCCGACCGCCGCCGATTCGGAGACCGGCGGTAGACAGAGG
TCGTCGTCCTACTCAATTCGAGTCCGCCAAGCGGGGGGCCCCAACAGTATAGACAACTTCGCGCGGTCTTGGCAG
AGAGCCGCGGCCTTCCCAGAGGTCCTCCCACGGCGGTTGTCGTTTGTCTCTGCGCAACCGCAATCGGACGATGAA
TTTGCCGTTGCCACTGGCCAAGCATATGTACCAAGAAGCTTCCCATCCTGGGGTCGGCACTCGGACGTGGACCGG
CCTCTGCTTCAGGACTCGGACTCGGACCAGGATGATGGAGACTCACGAGCGCCTGGATCTCCCAGGAGGGCACTA
CCTAGTGCTGGGCTGCTTGCTTCGTCGTTTGATAGAGCTTTTGCGACATCGTATGGCACCATCTCCTCACGGATG
AGTGATTCCACGCGGAGGAATGCGATTCAATTCCACCGAGAGCAGCATCCCCATGTGCATGTAGATGGGACTGAA
GATTTGGATGCGGGCCCATTACTTGTCAAGCATGTCCAACAGGAAGATGGCACCCAGGTGAATATCATCGTTGGG
CAATCTACCCTTCCGCAGACCATCTTCAACTCGGTCAATGTGTTGATTGGTATCGGTTTGTTGAGTCTTCCGTTG
GCGATGAAGCATGCCGGGTGGGGGTTGGGATTGGTATTTCTTGTCTTCTCGGCAGTTACCACTTCCTATACAGCC
AAGGTGCTGGCTAAATGTCTGGATGTCGACCAGACCGTTGTGACGTATGCCGATCTTGCTTATATCAGTTTCGGG
CAACATGCCCGTTTGGTTACAAGTTTCCTCTTCTGCTTGGAACTTTTAGGAGCATGTGTGGCGCTGGTTGTGCTC
TTTTCAGACAGTTTATATGCCCTGGTGCCAGGACTGAGCATCCTCCAATGGAAGATCGTGTGTGGAGTTGTGCTT
CTTCCGCTCAACTTCCTGCCCCTACGATTCCTGAGTATTACCAGCATATTGGGTATAATTTCGTGCACATCAATC
GTGATACTCATTTGCATCGATGGCTTCATTAAGCCAGATGCACCGGGCTCCTTGCGGCAGCCAGCTAAGACATTC
CTCTTCCCTGAAAACTGGGCTACCGTCCCTCTGAGTTTTGGTCTCATTATGTCACCTTGGGGTGGCCACGGCGTC
TTCCCTAACATCTACAGAGATATGAGGCATCCTCAGAAATACGGGAAGAGTCTTCGGGTGACCTATCTGTTTACA
TTTATTTTGGACTGCTCAATGGCGATCATTGGCTGGCTAATGTTTGGCGATGGCGTCCGCGACGAAATCACTGCG
AACATTCTCACGGTCACCAGTTACCCACAGGCCCTATCCGTTTGCATTGTAGTTTTCATCTCAATCATCCCCCTC
ACGAAAGTGCCCTTGAATGCTCGGCCTCTTGTGGCTACAATGGAAGTTCTTTGTGGACTCGGAGGGGGCCATGTT
CTTGCTGAAAACAGCTCAGGAACACGGCAAAGGATCGCACGGGCAATGGTGCGCGTTTTTATAGTGGCCATGATT
GTTGTTTTGGCGGTCATCTTCCCGGCTTTCGACCGTATCATGGCTTTCTTGGGGTCATTCTTGTGCTTCACGATC
TGTATCATCTTCCCTCTTGCATTTCATCTCAAGATCTTTGGAAAAGAGATCGGTCGAGGCGAGTACATCCTTGAT
TGGATTCTGCTCATCGTCTCCTCGATATTGGCAGCCGTGGGTACTGTCTTCGCCTTCTTACCGCAAGACATGCTC
TCTGCAAAGTAG
Transcript >Pro_DTO377G3_2|g1599.t1
ATGTCGAGGGCTGGAACAGATCAAGATCACGACAGTGAACCGGTATATGGCTCACGGAGGATACCGATTGCGACA
CCGAGCTCCCACGATCATGGCCATCTAGATGGTAGTCCGACCGCCGCCGATTCGGAGACCGGCGGTAGACAGAGG
TCGTCGTCCTACTCAATTCGAGTCCGCCAAGCGGGGGGCCCCAACAGTATAGACAACTTCGCGCGGTCTTGGCAG
AGAGCCGCGGCCTTCCCAGAGGTCCTCCCACGGCGGTTGTCGTTTGTCTCTGCGCAACCGCAATCGGACGATGAA
TTTGCCGTTGCCACTGGCCAAGCATATGTACCAAGAAGCTTCCCATCCTGGGGTCGGCACTCGGACGTGGACCGG
CCTCTGCTTCAGGACTCGGACTCGGACCAGGATGATGGAGACTCACGAGCGCCTGGATCTCCCAGGAGGGCACTA
CCTAGTGCTGGGCTGCTTGCTTCGTCGTTTGATAGAGCTTTTGCGACATCGTATGGCACCATCTCCTCACGGATG
AGTGATTCCACGCGGAGGAATGCGATTCAATTCCACCGAGAGCAGCATCCCCATGTGCATGTAGATGGGACTGAA
GATTTGGATGCGGGCCCATTACTTGTCAAGCATGTCCAACAGGAAGATGGCACCCAGGTGAATATCATCGTTGGG
CAATCTACCCTTCCGCAGACCATCTTCAACTCGGTCAATGTGTTGATTGGTATCGGTTTGTTGAGTCTTCCGTTG
GCGATGAAGCATGCCGGGTGGGGGTTGGGATTGGTATTTCTTGTCTTCTCGGCAGTTACCACTTCCTATACAGCC
AAGGTGCTGGCTAAATGTCTGGATGTCGACCAGACCGTTGTGACGTATGCCGATCTTGCTTATATCAGTTTCGGG
CAACATGCCCGTTTGGTTACAAGTTTCCTCTTCTGCTTGGAACTTTTAGGAGCATGTGTGGCGCTGGTTGTGCTC
TTTTCAGACAGTTTATATGCCCTGGTGCCAGGACTGAGCATCCTCCAATGGAAGATCGTGTGTGGAGTTGTGCTT
CTTCCGCTCAACTTCCTGCCCCTACGATTCCTGAGTATTACCAGCATATTGGGTATAATTTCGTGCACATCAATC
GTGATACTCATTTGCATCGATGGCTTCATTAAGCCAGATGCACCGGGCTCCTTGCGGCAGCCAGCTAAGACATTC
CTCTTCCCTGAAAACTGGGCTACCGTCCCTCTGAGTTTTGGTCTCATTATGTCACCTTGGGGTGGCCACGGCGTC
TTCCCTAACATCTACAGAGATATGAGGCATCCTCAGAAATACGGGAAGAGTCTTCGGGTGACCTATCTGTTTACA
TTTATTTTGGACTGCTCAATGGCGATCATTGGCTGGCTAATGTTTGGCGATGGCGTCCGCGACGAAATCACTGCG
AACATTCTCACGGTCACCAGTTACCCACAGGCCCTATCCGTTTGCATTGTAGTTTTCATCTCAATCATCCCCCTC
ACGAAAGTGCCCTTGAATGCTCGGCCTCTTGTGGCTACAATGGAAGTTCTTTGTGGACTCGGAGGGGGCCATGTT
CTTGCTGAAAACAGCTCAGGAACACGGCAAAGGATCGCACGGGCAATGGTGCGCGTTTTTATAGTGGCCATGATT
GTTGTTTTGGCGGTCATCTTCCCGGCTTTCGACCGTATCATGGCTTTCTTGGGGTCATTCTTGTGCTTCACGATC
TGTATCATCTTCCCTCTTGCATTTCATCTCAAGATCTTTGGAAAAGAGATCGGTCGAGGCGAGTACATCCTTGAT
TGGATTCTGCTCATCGTCTCCTCGATATTGGCAGCCGTGGGTACTGTCTTCGCCTTCTTACCGCAAGACATGCTC
TCTGCAAAGTAG
Gene >Pro_DTO377G3_2|g1599.t1
ATGTCGAGGGCTGGAACAGATCAAGATCACGACAGTGAACCGGTATATGGCTCACGGAGGATACCGATTGCGACA
CCGAGCTCCCACGATCATGGCCATCTAGATGGTAGTCCGACCGCCGCCGATTCGGAGACCGGCGGTAGACAGAGG
TATGTGATTTCTGTTGTTGAAAAAGCTAGACCGTTAGGCTCATTACTTTGCGCAGGTCGTCGTCCTACTCAATTC
GAGTCCGCCAAGCGGGGGGCCCCAACAGTATAGACAACTTCGCGCGGTCTTGGCAGAGAGCCGCGGCCTTCCCAG
AGGTCCTCCCACGGCGGTTGTCGTTTGTCTCTGCGCAACCGCAATCGGACGATGAATTTGCCGTTGCCACTGGCC
AAGCATATGTACCAAGAAGCTTCCCATCCTGGGGTCGGCACTCGGACGTGGACCGGCCTCTGCTTCAGGACTCGG
ACTCGGACCAGGATGATGGAGACTCACGAGCGCCTGGATCTCCCAGGAGGGCACTACCTAGTGCTGGGCTGCTTG
CTTCGTCGTTTGATAGAGCTTTTGCGACATCGTATGGCACCATCTCCTCACGGATGAGTGATTCCACGCGGAGGA
ATGCGATTCAATTCCACCGAGAGCAGCATCCCCATGTGCATGTAGATGGGACTGAAGATTTGGATGCGGGCCCAT
TACTTGTCAAGCATGTCCAACAGGAAGATGGCACCCAGGTGAATATCATCGTTGGGCAATCTACCCTTCCGCAGA
CCATCTTCAACTCGGTCAATGTGTTGATTGGTATCGGTTTGTTGAGTCTTCCGTTGGCGATGAAGCATGCCGGGT
GGGGGTTGGGATTGGTATTTCTTGTCTTCTCGGCAGTTACCACTTCCTATACAGCCAAGGTGCTGGCTAAATGTC
TGGATGTCGACCAGACCGTTGTGACGTATGCCGATCTTGCTTATATCAGTTTCGGGCAACATGCCCGTTTGGTTA
CAAGTTTCCTCTTCTGCTTGGAACTTTTAGGAGCATGTGTGGCGCTGGTTGTGCTCTTTTCAGACAGTTTATATG
CCCTGGTGCCAGGACTGAGCATCCTCCAATGGAAGATCGTGTGTGGAGTTGTGCTTCTTCCGCTCAACTTCCTGC
CCCTACGATTCCTGAGTATTACCAGCATATTGGGTATAATTTCGTGCACATCAAGTAAGTCCTCTTCCGAGCCGT
GCTGATAGATGGAACTGACATTCGAAAGTCGTGATACTCATTTGCATCGATGGCTTCATTAAGCCAGATGCACCG
GGCTCCTTGCGGCAGCCAGCTAAGACATTCCTCTTCCCTGAAAACTGGGCTACCGTCCCTCTGAGTTTTGGTCTC
ATTATGTGTGAGTGAAGGACAGAAAGGAATCGTGATCATGAGGCTAACTTGTTAAAAAGCACCTTGGGGTGGCCA
CGGCGTCTTCCCTAACATCTACAGAGATATGAGGCATCCTCAGAAATACGGGAAGAGTCTTCGGGTGACCTATCT
GTTTACAGTAAGAACATCAAGTCCCAGGATGAAGTTCAATTCTAACGAGTTGACAGTTTATTTTGGACTGCTCAA
TGGCGATCATTGGCTGGCTAATGTTTGGCGATGGCGTCCGCGACGAAATCACTGCGAACATTCTCACGGTCACCA
GTTACCCACAGGCCCTATCCGTTTGCATTGTAGTTTTCATCTCAATCATCCCCCTCACGAAAGTGCCCTTGAAGT
GAGTCTAACGTCTTCACTACTTCTCGGACATTGCTGACAAGTATATAGTGCTCGGCCTCTTGTGGCTACAATGGA
AGTTCTTTGTGGACTCGGAGGGGGCCATGTTCTTGCTGAAAACAGCTCAGGAACACGGCAAAGGATCGCACGGGC
AATGGTGCGCGTTTTTATAGTGGCCATGATTGTTGTTTTGGCGGTCATCTTCCCGGCTTTCGACCGTATCATGGC
TTTCTTGGGGTCATTCTTGTGCTTCACGATCTGTATCATCTTCCCTCTTGCATTTCATCTCAAGATCTTTGGAAA
AGAGATCGGTCGAGGCGAGTACATCCTTGATTGGATTCTGCTCATCGTCTCCTCGATATTGGCAGCCGTGGGTAC
TGTCTTCGCCTTCTTACCGCAAGACATGCTCTCTGCAAAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail