Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g1599.t1
Gene name
Locationscaffold_02:379392..381535
Strand-
Gene length (bp)2143
Transcript length (bp)1887
Coding sequence length (bp)1887
Protein length (aa) 629

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01490 Aa_trans Transmembrane amino acid transporter protein 5.0E-69 226 619

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 60 0.45

Transmembrane Domains

Domain # Start End Length
1 233 252 19
2 257 279 22
3 305 327 22
4 337 356 19
5 363 385 22
6 405 427 22
7 447 466 19
8 476 498 22
9 540 559 19
10 563 585 22
11 598 620 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g1599.t1
MSRAGTDQDHDSEPVYGSRRIPIATPSSHDHGHLDGSPTAADSETGGRQRSSSYSIRVRQAGGPNSIDNFARSWQ
RAAAFPEVLPRRLSFVSAQPQSDDEFAVATGQAYVPRSFPSWGRHSDVDRPLLQDSDSDQDDGDSRAPGSPRRAL
PSAGLLASSFDRAFATSYGTISSRMSDSTRRNAIQFHREQHPHVHVDGTEDLDAGPLLVKHVQQEDGTQVNIIVG
QSTLPQTIFNSVNVLIGIGLLSLPLAMKHAGWGLGLVFLVFSAVTTSYTAKVLAKCLDVDQTVVTYADLAYISFG
QHARLVTSFLFCLELLGACVALVVLFSDSLYALVPGLSILQWKIVCGVVLLPLNFLPLRFLSITSILGIISCTSI
VILICIDGFIKPDAPGSLRQPAKTFLFPENWATVPLSFGLIMSPWGGHGVFPNIYRDMRHPQKYGKSLRVTYLFT
FILDCSMAIIGWLMFGDGVRDEITANILTVTSYPQALSVCIVVFISIIPLTKVPLNARPLVATMEVLCGLGGGHV
LAENSSGTRQRIARAMVRVFIVAMIVVLAVIFPAFDRIMAFLGSFLCFTICIIFPLAFHLKIFGKEIGRGEYILD
WILLIVSSILAAVGTVFAFLPQDMLSAK*
Coding >Pro_DTO377G3_2|g1599.t1
ATGTCGAGGGCTGGAACAGATCAAGATCACGACAGTGAACCGGTATATGGCTCACGGAGGATACCGATTGCGACA
CCGAGCTCCCACGATCATGGCCATCTAGATGGTAGTCCGACCGCCGCCGATTCGGAGACCGGCGGTAGACAGAGG
TCGTCGTCCTACTCAATTCGAGTCCGCCAAGCGGGGGGCCCCAACAGTATAGACAACTTCGCGCGGTCTTGGCAG
AGAGCCGCGGCCTTCCCAGAGGTCCTCCCACGGCGGTTGTCGTTTGTCTCTGCGCAACCGCAATCGGACGATGAA
TTTGCCGTTGCCACTGGCCAAGCATATGTACCAAGAAGCTTCCCATCCTGGGGTCGGCACTCGGACGTGGACCGG
CCTCTGCTTCAGGACTCGGACTCGGACCAGGATGATGGAGACTCACGAGCGCCTGGATCTCCCAGGAGGGCACTA
CCTAGTGCTGGGCTGCTTGCTTCGTCGTTTGATAGAGCTTTTGCGACATCGTATGGCACCATCTCCTCACGGATG
AGTGATTCCACGCGGAGGAATGCGATTCAATTCCACCGAGAGCAGCATCCCCATGTGCATGTAGATGGGACTGAA
GATTTGGATGCGGGCCCATTACTTGTCAAGCATGTCCAACAGGAAGATGGCACCCAGGTGAATATCATCGTTGGG
CAATCTACCCTTCCGCAGACCATCTTCAACTCGGTCAATGTGTTGATTGGTATCGGTTTGTTGAGTCTTCCGTTG
GCGATGAAGCATGCCGGGTGGGGGTTGGGATTGGTATTTCTTGTCTTCTCGGCAGTTACCACTTCCTATACAGCC
AAGGTGCTGGCTAAATGTCTGGATGTCGACCAGACCGTTGTGACGTATGCCGATCTTGCTTATATCAGTTTCGGG
CAACATGCCCGTTTGGTTACAAGTTTCCTCTTCTGCTTGGAACTTTTAGGAGCATGTGTGGCGCTGGTTGTGCTC
TTTTCAGACAGTTTATATGCCCTGGTGCCAGGACTGAGCATCCTCCAATGGAAGATCGTGTGTGGAGTTGTGCTT
CTTCCGCTCAACTTCCTGCCCCTACGATTCCTGAGTATTACCAGCATATTGGGTATAATTTCGTGCACATCAATC
GTGATACTCATTTGCATCGATGGCTTCATTAAGCCAGATGCACCGGGCTCCTTGCGGCAGCCAGCTAAGACATTC
CTCTTCCCTGAAAACTGGGCTACCGTCCCTCTGAGTTTTGGTCTCATTATGTCACCTTGGGGTGGCCACGGCGTC
TTCCCTAACATCTACAGAGATATGAGGCATCCTCAGAAATACGGGAAGAGTCTTCGGGTGACCTATCTGTTTACA
TTTATTTTGGACTGCTCAATGGCGATCATTGGCTGGCTAATGTTTGGCGATGGCGTCCGCGACGAAATCACTGCG
AACATTCTCACGGTCACCAGTTACCCACAGGCCCTATCCGTTTGCATTGTAGTTTTCATCTCAATCATCCCCCTC
ACGAAAGTGCCCTTGAATGCTCGGCCTCTTGTGGCTACAATGGAAGTTCTTTGTGGACTCGGAGGGGGCCATGTT
CTTGCTGAAAACAGCTCAGGAACACGGCAAAGGATCGCACGGGCAATGGTGCGCGTTTTTATAGTGGCCATGATT
GTTGTTTTGGCGGTCATCTTCCCGGCTTTCGACCGTATCATGGCTTTCTTGGGGTCATTCTTGTGCTTCACGATC
TGTATCATCTTCCCTCTTGCATTTCATCTCAAGATCTTTGGAAAAGAGATCGGTCGAGGCGAGTACATCCTTGAT
TGGATTCTGCTCATCGTCTCCTCGATATTGGCAGCCGTGGGTACTGTCTTCGCCTTCTTACCGCAAGACATGCTC
TCTGCAAAGTAG
Transcript >Pro_DTO377G3_2|g1599.t1
ATGTCGAGGGCTGGAACAGATCAAGATCACGACAGTGAACCGGTATATGGCTCACGGAGGATACCGATTGCGACA
CCGAGCTCCCACGATCATGGCCATCTAGATGGTAGTCCGACCGCCGCCGATTCGGAGACCGGCGGTAGACAGAGG
TCGTCGTCCTACTCAATTCGAGTCCGCCAAGCGGGGGGCCCCAACAGTATAGACAACTTCGCGCGGTCTTGGCAG
AGAGCCGCGGCCTTCCCAGAGGTCCTCCCACGGCGGTTGTCGTTTGTCTCTGCGCAACCGCAATCGGACGATGAA
TTTGCCGTTGCCACTGGCCAAGCATATGTACCAAGAAGCTTCCCATCCTGGGGTCGGCACTCGGACGTGGACCGG
CCTCTGCTTCAGGACTCGGACTCGGACCAGGATGATGGAGACTCACGAGCGCCTGGATCTCCCAGGAGGGCACTA
CCTAGTGCTGGGCTGCTTGCTTCGTCGTTTGATAGAGCTTTTGCGACATCGTATGGCACCATCTCCTCACGGATG
AGTGATTCCACGCGGAGGAATGCGATTCAATTCCACCGAGAGCAGCATCCCCATGTGCATGTAGATGGGACTGAA
GATTTGGATGCGGGCCCATTACTTGTCAAGCATGTCCAACAGGAAGATGGCACCCAGGTGAATATCATCGTTGGG
CAATCTACCCTTCCGCAGACCATCTTCAACTCGGTCAATGTGTTGATTGGTATCGGTTTGTTGAGTCTTCCGTTG
GCGATGAAGCATGCCGGGTGGGGGTTGGGATTGGTATTTCTTGTCTTCTCGGCAGTTACCACTTCCTATACAGCC
AAGGTGCTGGCTAAATGTCTGGATGTCGACCAGACCGTTGTGACGTATGCCGATCTTGCTTATATCAGTTTCGGG
CAACATGCCCGTTTGGTTACAAGTTTCCTCTTCTGCTTGGAACTTTTAGGAGCATGTGTGGCGCTGGTTGTGCTC
TTTTCAGACAGTTTATATGCCCTGGTGCCAGGACTGAGCATCCTCCAATGGAAGATCGTGTGTGGAGTTGTGCTT
CTTCCGCTCAACTTCCTGCCCCTACGATTCCTGAGTATTACCAGCATATTGGGTATAATTTCGTGCACATCAATC
GTGATACTCATTTGCATCGATGGCTTCATTAAGCCAGATGCACCGGGCTCCTTGCGGCAGCCAGCTAAGACATTC
CTCTTCCCTGAAAACTGGGCTACCGTCCCTCTGAGTTTTGGTCTCATTATGTCACCTTGGGGTGGCCACGGCGTC
TTCCCTAACATCTACAGAGATATGAGGCATCCTCAGAAATACGGGAAGAGTCTTCGGGTGACCTATCTGTTTACA
TTTATTTTGGACTGCTCAATGGCGATCATTGGCTGGCTAATGTTTGGCGATGGCGTCCGCGACGAAATCACTGCG
AACATTCTCACGGTCACCAGTTACCCACAGGCCCTATCCGTTTGCATTGTAGTTTTCATCTCAATCATCCCCCTC
ACGAAAGTGCCCTTGAATGCTCGGCCTCTTGTGGCTACAATGGAAGTTCTTTGTGGACTCGGAGGGGGCCATGTT
CTTGCTGAAAACAGCTCAGGAACACGGCAAAGGATCGCACGGGCAATGGTGCGCGTTTTTATAGTGGCCATGATT
GTTGTTTTGGCGGTCATCTTCCCGGCTTTCGACCGTATCATGGCTTTCTTGGGGTCATTCTTGTGCTTCACGATC
TGTATCATCTTCCCTCTTGCATTTCATCTCAAGATCTTTGGAAAAGAGATCGGTCGAGGCGAGTACATCCTTGAT
TGGATTCTGCTCATCGTCTCCTCGATATTGGCAGCCGTGGGTACTGTCTTCGCCTTCTTACCGCAAGACATGCTC
TCTGCAAAGTAG
Gene >Pro_DTO377G3_2|g1599.t1
ATGTCGAGGGCTGGAACAGATCAAGATCACGACAGTGAACCGGTATATGGCTCACGGAGGATACCGATTGCGACA
CCGAGCTCCCACGATCATGGCCATCTAGATGGTAGTCCGACCGCCGCCGATTCGGAGACCGGCGGTAGACAGAGG
TATGTGATTTCTGTTGTTGAAAAAGCTAGACCGTTAGGCTCATTACTTTGCGCAGGTCGTCGTCCTACTCAATTC
GAGTCCGCCAAGCGGGGGGCCCCAACAGTATAGACAACTTCGCGCGGTCTTGGCAGAGAGCCGCGGCCTTCCCAG
AGGTCCTCCCACGGCGGTTGTCGTTTGTCTCTGCGCAACCGCAATCGGACGATGAATTTGCCGTTGCCACTGGCC
AAGCATATGTACCAAGAAGCTTCCCATCCTGGGGTCGGCACTCGGACGTGGACCGGCCTCTGCTTCAGGACTCGG
ACTCGGACCAGGATGATGGAGACTCACGAGCGCCTGGATCTCCCAGGAGGGCACTACCTAGTGCTGGGCTGCTTG
CTTCGTCGTTTGATAGAGCTTTTGCGACATCGTATGGCACCATCTCCTCACGGATGAGTGATTCCACGCGGAGGA
ATGCGATTCAATTCCACCGAGAGCAGCATCCCCATGTGCATGTAGATGGGACTGAAGATTTGGATGCGGGCCCAT
TACTTGTCAAGCATGTCCAACAGGAAGATGGCACCCAGGTGAATATCATCGTTGGGCAATCTACCCTTCCGCAGA
CCATCTTCAACTCGGTCAATGTGTTGATTGGTATCGGTTTGTTGAGTCTTCCGTTGGCGATGAAGCATGCCGGGT
GGGGGTTGGGATTGGTATTTCTTGTCTTCTCGGCAGTTACCACTTCCTATACAGCCAAGGTGCTGGCTAAATGTC
TGGATGTCGACCAGACCGTTGTGACGTATGCCGATCTTGCTTATATCAGTTTCGGGCAACATGCCCGTTTGGTTA
CAAGTTTCCTCTTCTGCTTGGAACTTTTAGGAGCATGTGTGGCGCTGGTTGTGCTCTTTTCAGACAGTTTATATG
CCCTGGTGCCAGGACTGAGCATCCTCCAATGGAAGATCGTGTGTGGAGTTGTGCTTCTTCCGCTCAACTTCCTGC
CCCTACGATTCCTGAGTATTACCAGCATATTGGGTATAATTTCGTGCACATCAAGTAAGTCCTCTTCCGAGCCGT
GCTGATAGATGGAACTGACATTCGAAAGTCGTGATACTCATTTGCATCGATGGCTTCATTAAGCCAGATGCACCG
GGCTCCTTGCGGCAGCCAGCTAAGACATTCCTCTTCCCTGAAAACTGGGCTACCGTCCCTCTGAGTTTTGGTCTC
ATTATGTGTGAGTGAAGGACAGAAAGGAATCGTGATCATGAGGCTAACTTGTTAAAAAGCACCTTGGGGTGGCCA
CGGCGTCTTCCCTAACATCTACAGAGATATGAGGCATCCTCAGAAATACGGGAAGAGTCTTCGGGTGACCTATCT
GTTTACAGTAAGAACATCAAGTCCCAGGATGAAGTTCAATTCTAACGAGTTGACAGTTTATTTTGGACTGCTCAA
TGGCGATCATTGGCTGGCTAATGTTTGGCGATGGCGTCCGCGACGAAATCACTGCGAACATTCTCACGGTCACCA
GTTACCCACAGGCCCTATCCGTTTGCATTGTAGTTTTCATCTCAATCATCCCCCTCACGAAAGTGCCCTTGAAGT
GAGTCTAACGTCTTCACTACTTCTCGGACATTGCTGACAAGTATATAGTGCTCGGCCTCTTGTGGCTACAATGGA
AGTTCTTTGTGGACTCGGAGGGGGCCATGTTCTTGCTGAAAACAGCTCAGGAACACGGCAAAGGATCGCACGGGC
AATGGTGCGCGTTTTTATAGTGGCCATGATTGTTGTTTTGGCGGTCATCTTCCCGGCTTTCGACCGTATCATGGC
TTTCTTGGGGTCATTCTTGTGCTTCACGATCTGTATCATCTTCCCTCTTGCATTTCATCTCAAGATCTTTGGAAA
AGAGATCGGTCGAGGCGAGTACATCCTTGATTGGATTCTGCTCATCGTCTCCTCGATATTGGCAGCCGTGGGTAC
TGTCTTCGCCTTCTTACCGCAAGACATGCTCTCTGCAAAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail