Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g159.t1
Gene name
Locationscaffold_01:414824..419995
Strand-
Gene length (bp)5171
Transcript length (bp)4467
Coding sequence length (bp)4467
Protein length (aa) 1489

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00636 Ribonuclease_3 Ribonuclease III domain 4.2E-19 1042 1154
PF00636 Ribonuclease_3 Ribonuclease III domain 1.5E-20 1242 1356
PF14622 Ribonucleas_3_3 Ribonuclease-III-like 1.7E-09 1026 1158
PF14622 Ribonucleas_3_3 Ribonuclease-III-like 1.0E-13 1220 1371
PF03368 Dicer_dimer Dicer dimerisation domain 2.8E-20 602 688
PF00271 Helicase_C Helicase conserved C-terminal domain 1.8E-15 413 523
PF04851 ResIII Type III restriction enzyme, res subunit 1.1E-13 80 249
PF00270 DEAD DEAD/DEAH box helicase 9.9E-11 83 248

GO

GO Term Description Terminal node
GO:0016891 endoribonuclease activity, producing 5'-phosphomonoesters Yes
GO:0005524 ATP binding Yes
GO:0006396 RNA processing Yes
GO:0003676 nucleic acid binding Yes
GO:0003677 DNA binding Yes
GO:0016787 hydrolase activity Yes
GO:0004525 ribonuclease III activity Yes
GO:0032559 adenyl ribonucleotide binding No
GO:1901265 nucleoside phosphate binding No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0009987 cellular process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0044238 primary metabolic process No
GO:0004521 endoribonuclease activity No
GO:0043168 anion binding No
GO:0016893 endonuclease activity, active with either ribo- or deoxyribonucleic acids and producing 5'-phosphomonoesters No
GO:0003824 catalytic activity No
GO:1901360 organic cyclic compound metabolic process No
GO:0032553 ribonucleotide binding No
GO:0071704 organic substance metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0032555 purine ribonucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0090304 nucleic acid metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0004540 ribonuclease activity No
GO:0043167 ion binding No
GO:0036094 small molecule binding No
GO:0004519 endonuclease activity No
GO:0044237 cellular metabolic process No
GO:0016070 RNA metabolic process No
GO:0005488 binding No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0006725 cellular aromatic compound metabolic process No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0032296 double-stranded RNA-specific ribonuclease activity No
GO:0004518 nuclease activity No
GO:0017076 purine nucleotide binding No
GO:0006807 nitrogen compound metabolic process No
GO:0003674 molecular_function No
GO:0008144 drug binding No
GO:0000166 nucleotide binding No
GO:0008150 biological_process No
GO:0140098 catalytic activity, acting on RNA No
GO:0008152 metabolic process No
GO:0030554 adenyl nucleotide binding No
GO:0097367 carbohydrate derivative binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 50 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g159.t1
MEAEDTSSDLSGDEAATPQLKVSHRHRTQNAMFNALLEDHVVNGPKDGPNASHIELSDAELSTARLLANTEPGGG
VLDPREYQIELFERARASNTIAVLDTGSGKTLVAVLLLKHILQIELNKRANGASPRVAFFLVDSVTLVFQQSAVL
RNNLDQRVAHFYGNLGPDLWDQQTWNKHLEKYMVIVCTAEILNQSLLNGHIRIDQINLLIFDEAHHAKKEHPYAR
IIRDSYLKADPEKRPRIFGMTASPVDAKCDIAEAAIQLETLLDSRIATTSDLTLLRNFVNKPMEEEWVYDKLPPP
FETNLHGTLKVKYGDMPILEGAFRFASVASSELGAWCADQVWALALADEVLPKLEGSIGKVTDSDPQDSEKASED
IKRIQEANQLVKEYIENQAFTPADLSSKVELLMRKLQEQFAKSPDTKCIVFTQRRNTAKIMLQLCEKLQLPNLRP
DALVGVRKGDALGMNSTFRRQFLVLVKFRKSEVNCLFATSVAEEGLDIPDCNLVVRFDLFDTVIQYVQSRGRARS
ADSVYATMVESGNHNHSMRLQEVRRAEHLMKNFCNLLPEDRKLYGADHDTKGLIHEEDRKRTYTIPNTGAMLTCR
HAIGVLARFASSLQYENEISASVTYIVMSENESFSCEIIMPEKSPVRRVIGRSESKKSLAKQSAAFDACMLLRQK
NLLDEHFNSIYHKRLPAMRNAKLAITSKRTDQYRMRTKPSIWARLQGTVPTRLYAIVIRLIPSKPLARAHGSIVL
LTRERITTIPTFPVFLDKDIETTVQSLCIDDGLEVASKDLEYLTVFTLAVFHDVFHKTYKHVSEQFPYWLAPARE
DVDIGTSTSIFDIIDWEALQYVRDNPKLMWSSDMEPESLLTRFIYDDWNGKYRYFPLAIDPNLRPSDPPPSYAPS
RKWSDNIMNWSLSLSKNSRPKFFNRCIWTQPVFQAELICLRRNFLDKAAEEEKASNSRCVICPQPLAISAISTSV
AATCFVFPAIITRMESYLIAQEGCNMLGLGGIKLEYALEAFTKDSDNTEEHRSLQIHVQRGMGKNYERLELLGDS
VLKMATSISLFIQNPEDDEYDYHVNRMCLICNKNLFRNAIELKLYEYIRSRGFSRHMWYPPGLSLEYGRDHAKFF
ASEGKHSLAEKTIADVCEALIGASLLSGGDDNRYDMAIKAVTVFVNSHNHTATSWEDYLSAYSMPLYQNRAADGF
EKNLAQQIFEKVGYEFKYPRLLRSAFTHPSYPLAWAKVPCYQRLEFLGDALLDMVCVEHLFHRFPNRDPQWLTEH
KMAMVSNKFLGALAVKLGLHVHLQHFSNPLMIQNNKYAEEIQLAESEGNGEVDYWLSTSDSPKCLPDMLEAYLGA
IFVDSGFDFTVIEAFFNMHILPFFHDMSIYDTFANRHPTTFLHSQMTHSYQCTDYCLKSAEVPAVEGETPRVFAA
VMVHGQSIASAVASSSRYAKVRASTRALAVIDGMSLSEFREKYHCACQGGQATVDRASIGTAI*
Coding >Pro_DTO377G3_2|g159.t1
ATGGAGGCTGAAGATACTAGCTCAGATCTATCTGGCGACGAAGCTGCGACCCCACAATTGAAGGTGTCGCACCGA
CACAGAACTCAAAATGCTATGTTTAATGCGCTGCTTGAAGACCATGTCGTCAACGGGCCTAAAGACGGTCCCAAT
GCATCACATATCGAACTATCTGATGCGGAACTTTCAACTGCTCGTTTGCTCGCGAATACAGAGCCCGGAGGTGGA
GTTCTAGATCCTCGCGAATACCAAATCGAGCTCTTTGAAAGAGCACGGGCTAGCAACACGATCGCGGTTCTCGAC
ACAGGGTCTGGGAAGACTTTAGTGGCCGTGCTTTTGCTCAAGCATATTCTCCAAATCGAACTCAACAAACGTGCA
AATGGCGCAAGTCCTCGCGTTGCCTTTTTCCTGGTCGACAGTGTGACTTTGGTTTTTCAACAGTCTGCGGTATTG
AGAAACAATCTCGATCAAAGAGTCGCTCATTTTTATGGCAATCTGGGACCCGATCTTTGGGACCAACAGACGTGG
AACAAGCATCTTGAAAAGTACATGGTGATTGTATGCACGGCGGAGATTCTAAACCAATCTCTACTGAATGGCCAT
ATAAGAATTGACCAGATCAATCTTCTGATCTTCGACGAAGCTCACCATGCCAAGAAGGAGCATCCGTATGCTCGT
ATCATCCGAGACAGCTATCTGAAAGCGGATCCTGAAAAGCGCCCAAGGATCTTCGGGATGACCGCTTCCCCGGTT
GATGCTAAGTGTGACATAGCGGAAGCAGCAATCCAACTTGAGACTCTTTTAGATAGTCGCATTGCAACAACCTCA
GATCTTACCCTCCTGCGGAATTTCGTGAACAAGCCAATGGAAGAGGAATGGGTCTACGACAAGCTTCCTCCGCCG
TTTGAGACCAATCTACATGGTACTTTGAAAGTCAAGTATGGTGATATGCCAATACTAGAGGGCGCATTTCGATTT
GCATCGGTTGCAAGCTCGGAATTAGGGGCTTGGTGCGCAGACCAGGTATGGGCCTTGGCCCTGGCTGACGAAGTG
CTGCCCAAGCTGGAGGGTAGTATCGGCAAAGTCACCGATTCTGATCCCCAGGATTCTGAAAAGGCCTCAGAGGAC
ATTAAGCGGATCCAAGAAGCCAACCAGCTCGTCAAGGAATACATTGAAAACCAGGCATTTACGCCGGCTGATCTC
AGCTCCAAAGTAGAGCTTTTAATGAGAAAGTTGCAAGAACAGTTTGCGAAGTCGCCAGATACCAAATGCATTGTG
TTCACACAACGGCGCAATACAGCTAAAATAATGTTACAGCTGTGCGAAAAGCTGCAACTCCCAAACCTCCGTCCC
GATGCTTTGGTTGGTGTTCGCAAAGGAGATGCTCTAGGAATGAATTCCACGTTTCGTCGGCAGTTTCTTGTCTTG
GTCAAGTTCCGAAAAAGTGAAGTCAACTGCTTGTTTGCAACATCGGTCGCAGAGGAAGGCCTTGACATCCCAGAT
TGTAATCTGGTGGTAAGATTCGATCTGTTTGACACGGTAATTCAATATGTCCAAAGCCGAGGCCGTGCCAGAAGC
GCTGATTCAGTGTACGCAACTATGGTCGAAAGTGGCAATCACAACCACAGCATGAGACTACAGGAAGTTCGAAGA
GCAGAGCACCTCATGAAGAATTTCTGCAATCTGCTGCCGGAGGATCGAAAATTGTACGGAGCCGATCACGATACG
AAAGGGCTTATTCACGAGGAAGATAGGAAGAGAACATACACCATCCCGAACACAGGTGCCATGTTAACCTGTCGC
CATGCGATTGGTGTATTGGCACGATTTGCCAGCTCATTGCAATACGAAAATGAGATATCAGCATCGGTCACATAC
ATTGTGATGTCAGAGAACGAATCATTCAGCTGTGAGATAATTATGCCGGAGAAGTCGCCTGTGCGAAGAGTGATT
GGACGTTCCGAATCGAAGAAATCACTCGCCAAGCAGTCCGCTGCTTTTGATGCGTGTATGCTGCTTCGCCAAAAG
AATCTGTTGGATGAGCACTTCAACTCTATCTACCACAAGCGCTTGCCAGCAATGCGCAATGCCAAACTGGCTATT
ACTTCAAAGAGGACTGATCAGTACCGAATGCGTACTAAGCCCTCAATCTGGGCTAGGCTGCAGGGAACCGTTCCC
ACACGCCTCTACGCGATAGTTATTCGTCTCATTCCATCAAAGCCTCTGGCTCGAGCTCATGGAAGTATTGTATTG
CTTACACGAGAGCGAATCACTACAATTCCGACTTTCCCGGTCTTCTTGGATAAGGATATCGAGACTACAGTTCAG
TCTTTGTGTATTGACGACGGCCTCGAGGTTGCTTCCAAAGATCTCGAATATCTGACTGTATTTACACTTGCTGTC
TTTCATGACGTGTTTCACAAGACCTATAAGCACGTCTCGGAACAGTTTCCATACTGGCTTGCGCCTGCTCGAGAA
GATGTCGACATTGGAACGTCAACAAGTATCTTTGACATAATTGACTGGGAGGCTTTACAATATGTCCGAGATAAC
CCCAAGCTTATGTGGTCTTCTGACATGGAGCCAGAATCGTTGCTGACTCGATTCATCTACGACGATTGGAATGGA
AAGTATCGATACTTCCCGCTTGCTATAGACCCCAATCTACGTCCTTCAGACCCACCCCCATCCTACGCACCATCT
CGAAAATGGTCAGACAATATCATGAATTGGTCCTTGAGTTTGAGCAAAAATTCACGTCCCAAATTCTTCAACCGA
TGTATCTGGACCCAACCGGTCTTCCAGGCGGAGTTGATCTGCCTTCGGCGGAACTTCCTTGATAAAGCGGCCGAG
GAAGAGAAAGCATCCAACTCGAGATGTGTCATTTGCCCTCAGCCCTTGGCTATATCGGCGATTTCCACGTCTGTG
GCCGCGACGTGTTTTGTCTTTCCAGCAATTATCACGCGAATGGAATCCTACCTGATCGCCCAGGAGGGATGCAAT
ATGCTAGGTCTTGGTGGCATTAAGCTCGAGTATGCCCTGGAGGCCTTCACCAAGGATTCAGACAACACCGAAGAG
CATCGGAGCCTACAGATTCACGTTCAACGAGGAATGGGGAAAAATTACGAGCGCCTTGAACTACTAGGGGACTCT
GTGCTCAAGATGGCAACATCCATTTCGCTCTTTATTCAAAATCCGGAGGATGATGAATACGACTACCACGTTAAC
AGAATGTGTCTCATCTGCAACAAGAACCTGTTCAGAAACGCAATTGAACTGAAACTCTATGAGTACATACGTAGC
CGTGGGTTCTCTCGACATATGTGGTACCCCCCAGGTCTTTCGCTCGAGTATGGTCGGGACCACGCCAAGTTTTTT
GCCAGTGAAGGTAAGCACTCCTTGGCTGAGAAGACTATAGCAGATGTCTGCGAGGCATTGATAGGAGCATCGTTG
CTCTCGGGAGGTGATGACAATCGGTATGATATGGCTATCAAAGCTGTCACCGTCTTCGTCAACAGTCATAACCAC
ACGGCAACCTCATGGGAAGACTACCTCTCAGCATATTCCATGCCTTTGTATCAGAACAGGGCAGCGGATGGATTT
GAAAAGAACCTGGCCCAGCAAATCTTCGAGAAAGTAGGCTACGAGTTCAAGTACCCTCGTCTCCTGCGGTCGGCT
TTCACGCATCCATCTTATCCATTGGCATGGGCTAAGGTGCCTTGTTATCAGAGGCTCGAGTTCTTGGGTGATGCA
CTCCTGGATATGGTGTGCGTGGAGCACTTGTTTCATCGGTTCCCCAACCGAGATCCGCAGTGGTTGACTGAACAC
AAGATGGCTATGGTATCCAACAAATTTCTTGGTGCTTTGGCTGTAAAACTGGGGCTTCATGTTCATCTTCAGCAT
TTCAGCAATCCTCTCATGATCCAAAACAACAAATACGCAGAGGAAATTCAGCTTGCAGAGAGCGAAGGCAACGGA
GAGGTCGACTACTGGCTTTCGACGTCAGATTCCCCAAAGTGTCTTCCCGACATGCTTGAGGCTTATCTGGGTGCT
ATATTTGTTGATTCTGGCTTCGACTTCACAGTTATTGAAGCCTTCTTCAACATGCATATCCTACCATTTTTCCAC
GACATGTCTATTTACGACACATTTGCAAACAGACATCCAACGACATTCCTTCATAGCCAAATGACTCACAGCTAC
CAATGCACCGATTACTGCTTGAAATCTGCAGAGGTCCCTGCCGTGGAAGGGGAGACCCCCAGGGTCTTTGCTGCG
GTTATGGTGCACGGCCAATCCATTGCCAGCGCAGTCGCATCTTCTAGTCGGTATGCTAAAGTGAGGGCTAGTACC
CGGGCATTGGCTGTTATTGATGGAATGTCTCTTTCCGAGTTCCGAGAGAAATATCACTGTGCTTGTCAAGGTGGA
CAAGCCACCGTGGACCGCGCAAGTATCGGAACGGCAATTTGA
Transcript >Pro_DTO377G3_2|g159.t1
ATGGAGGCTGAAGATACTAGCTCAGATCTATCTGGCGACGAAGCTGCGACCCCACAATTGAAGGTGTCGCACCGA
CACAGAACTCAAAATGCTATGTTTAATGCGCTGCTTGAAGACCATGTCGTCAACGGGCCTAAAGACGGTCCCAAT
GCATCACATATCGAACTATCTGATGCGGAACTTTCAACTGCTCGTTTGCTCGCGAATACAGAGCCCGGAGGTGGA
GTTCTAGATCCTCGCGAATACCAAATCGAGCTCTTTGAAAGAGCACGGGCTAGCAACACGATCGCGGTTCTCGAC
ACAGGGTCTGGGAAGACTTTAGTGGCCGTGCTTTTGCTCAAGCATATTCTCCAAATCGAACTCAACAAACGTGCA
AATGGCGCAAGTCCTCGCGTTGCCTTTTTCCTGGTCGACAGTGTGACTTTGGTTTTTCAACAGTCTGCGGTATTG
AGAAACAATCTCGATCAAAGAGTCGCTCATTTTTATGGCAATCTGGGACCCGATCTTTGGGACCAACAGACGTGG
AACAAGCATCTTGAAAAGTACATGGTGATTGTATGCACGGCGGAGATTCTAAACCAATCTCTACTGAATGGCCAT
ATAAGAATTGACCAGATCAATCTTCTGATCTTCGACGAAGCTCACCATGCCAAGAAGGAGCATCCGTATGCTCGT
ATCATCCGAGACAGCTATCTGAAAGCGGATCCTGAAAAGCGCCCAAGGATCTTCGGGATGACCGCTTCCCCGGTT
GATGCTAAGTGTGACATAGCGGAAGCAGCAATCCAACTTGAGACTCTTTTAGATAGTCGCATTGCAACAACCTCA
GATCTTACCCTCCTGCGGAATTTCGTGAACAAGCCAATGGAAGAGGAATGGGTCTACGACAAGCTTCCTCCGCCG
TTTGAGACCAATCTACATGGTACTTTGAAAGTCAAGTATGGTGATATGCCAATACTAGAGGGCGCATTTCGATTT
GCATCGGTTGCAAGCTCGGAATTAGGGGCTTGGTGCGCAGACCAGGTATGGGCCTTGGCCCTGGCTGACGAAGTG
CTGCCCAAGCTGGAGGGTAGTATCGGCAAAGTCACCGATTCTGATCCCCAGGATTCTGAAAAGGCCTCAGAGGAC
ATTAAGCGGATCCAAGAAGCCAACCAGCTCGTCAAGGAATACATTGAAAACCAGGCATTTACGCCGGCTGATCTC
AGCTCCAAAGTAGAGCTTTTAATGAGAAAGTTGCAAGAACAGTTTGCGAAGTCGCCAGATACCAAATGCATTGTG
TTCACACAACGGCGCAATACAGCTAAAATAATGTTACAGCTGTGCGAAAAGCTGCAACTCCCAAACCTCCGTCCC
GATGCTTTGGTTGGTGTTCGCAAAGGAGATGCTCTAGGAATGAATTCCACGTTTCGTCGGCAGTTTCTTGTCTTG
GTCAAGTTCCGAAAAAGTGAAGTCAACTGCTTGTTTGCAACATCGGTCGCAGAGGAAGGCCTTGACATCCCAGAT
TGTAATCTGGTGGTAAGATTCGATCTGTTTGACACGGTAATTCAATATGTCCAAAGCCGAGGCCGTGCCAGAAGC
GCTGATTCAGTGTACGCAACTATGGTCGAAAGTGGCAATCACAACCACAGCATGAGACTACAGGAAGTTCGAAGA
GCAGAGCACCTCATGAAGAATTTCTGCAATCTGCTGCCGGAGGATCGAAAATTGTACGGAGCCGATCACGATACG
AAAGGGCTTATTCACGAGGAAGATAGGAAGAGAACATACACCATCCCGAACACAGGTGCCATGTTAACCTGTCGC
CATGCGATTGGTGTATTGGCACGATTTGCCAGCTCATTGCAATACGAAAATGAGATATCAGCATCGGTCACATAC
ATTGTGATGTCAGAGAACGAATCATTCAGCTGTGAGATAATTATGCCGGAGAAGTCGCCTGTGCGAAGAGTGATT
GGACGTTCCGAATCGAAGAAATCACTCGCCAAGCAGTCCGCTGCTTTTGATGCGTGTATGCTGCTTCGCCAAAAG
AATCTGTTGGATGAGCACTTCAACTCTATCTACCACAAGCGCTTGCCAGCAATGCGCAATGCCAAACTGGCTATT
ACTTCAAAGAGGACTGATCAGTACCGAATGCGTACTAAGCCCTCAATCTGGGCTAGGCTGCAGGGAACCGTTCCC
ACACGCCTCTACGCGATAGTTATTCGTCTCATTCCATCAAAGCCTCTGGCTCGAGCTCATGGAAGTATTGTATTG
CTTACACGAGAGCGAATCACTACAATTCCGACTTTCCCGGTCTTCTTGGATAAGGATATCGAGACTACAGTTCAG
TCTTTGTGTATTGACGACGGCCTCGAGGTTGCTTCCAAAGATCTCGAATATCTGACTGTATTTACACTTGCTGTC
TTTCATGACGTGTTTCACAAGACCTATAAGCACGTCTCGGAACAGTTTCCATACTGGCTTGCGCCTGCTCGAGAA
GATGTCGACATTGGAACGTCAACAAGTATCTTTGACATAATTGACTGGGAGGCTTTACAATATGTCCGAGATAAC
CCCAAGCTTATGTGGTCTTCTGACATGGAGCCAGAATCGTTGCTGACTCGATTCATCTACGACGATTGGAATGGA
AAGTATCGATACTTCCCGCTTGCTATAGACCCCAATCTACGTCCTTCAGACCCACCCCCATCCTACGCACCATCT
CGAAAATGGTCAGACAATATCATGAATTGGTCCTTGAGTTTGAGCAAAAATTCACGTCCCAAATTCTTCAACCGA
TGTATCTGGACCCAACCGGTCTTCCAGGCGGAGTTGATCTGCCTTCGGCGGAACTTCCTTGATAAAGCGGCCGAG
GAAGAGAAAGCATCCAACTCGAGATGTGTCATTTGCCCTCAGCCCTTGGCTATATCGGCGATTTCCACGTCTGTG
GCCGCGACGTGTTTTGTCTTTCCAGCAATTATCACGCGAATGGAATCCTACCTGATCGCCCAGGAGGGATGCAAT
ATGCTAGGTCTTGGTGGCATTAAGCTCGAGTATGCCCTGGAGGCCTTCACCAAGGATTCAGACAACACCGAAGAG
CATCGGAGCCTACAGATTCACGTTCAACGAGGAATGGGGAAAAATTACGAGCGCCTTGAACTACTAGGGGACTCT
GTGCTCAAGATGGCAACATCCATTTCGCTCTTTATTCAAAATCCGGAGGATGATGAATACGACTACCACGTTAAC
AGAATGTGTCTCATCTGCAACAAGAACCTGTTCAGAAACGCAATTGAACTGAAACTCTATGAGTACATACGTAGC
CGTGGGTTCTCTCGACATATGTGGTACCCCCCAGGTCTTTCGCTCGAGTATGGTCGGGACCACGCCAAGTTTTTT
GCCAGTGAAGGTAAGCACTCCTTGGCTGAGAAGACTATAGCAGATGTCTGCGAGGCATTGATAGGAGCATCGTTG
CTCTCGGGAGGTGATGACAATCGGTATGATATGGCTATCAAAGCTGTCACCGTCTTCGTCAACAGTCATAACCAC
ACGGCAACCTCATGGGAAGACTACCTCTCAGCATATTCCATGCCTTTGTATCAGAACAGGGCAGCGGATGGATTT
GAAAAGAACCTGGCCCAGCAAATCTTCGAGAAAGTAGGCTACGAGTTCAAGTACCCTCGTCTCCTGCGGTCGGCT
TTCACGCATCCATCTTATCCATTGGCATGGGCTAAGGTGCCTTGTTATCAGAGGCTCGAGTTCTTGGGTGATGCA
CTCCTGGATATGGTGTGCGTGGAGCACTTGTTTCATCGGTTCCCCAACCGAGATCCGCAGTGGTTGACTGAACAC
AAGATGGCTATGGTATCCAACAAATTTCTTGGTGCTTTGGCTGTAAAACTGGGGCTTCATGTTCATCTTCAGCAT
TTCAGCAATCCTCTCATGATCCAAAACAACAAATACGCAGAGGAAATTCAGCTTGCAGAGAGCGAAGGCAACGGA
GAGGTCGACTACTGGCTTTCGACGTCAGATTCCCCAAAGTGTCTTCCCGACATGCTTGAGGCTTATCTGGGTGCT
ATATTTGTTGATTCTGGCTTCGACTTCACAGTTATTGAAGCCTTCTTCAACATGCATATCCTACCATTTTTCCAC
GACATGTCTATTTACGACACATTTGCAAACAGACATCCAACGACATTCCTTCATAGCCAAATGACTCACAGCTAC
CAATGCACCGATTACTGCTTGAAATCTGCAGAGGTCCCTGCCGTGGAAGGGGAGACCCCCAGGGTCTTTGCTGCG
GTTATGGTGCACGGCCAATCCATTGCCAGCGCAGTCGCATCTTCTAGTCGGTATGCTAAAGTGAGGGCTAGTACC
CGGGCATTGGCTGTTATTGATGGAATGTCTCTTTCCGAGTTCCGAGAGAAATATCACTGTGCTTGTCAAGGTGGA
CAAGCCACCGTGGACCGCGCAAGTATCGGAACGGCAATTTGA
Gene >Pro_DTO377G3_2|g159.t1
ATGGAGGCTGAAGATACTAGCTCAGATCTATCTGGCGACGAAGCTGCGACCCCACAATTGAAGGTGTCGCACCGA
CACAGAACTCAAAATGCTATGTTTAATGCGCTGTAAGTTCTTGATATATCTTAGCTTGAAGACCAATGCTGACAG
TTCGGAAGGCTTGAAGACCATGTCGTCAACGGGCCTAAAGACGGTCCCAATGCATCACATATCGAACTATCTGAT
GCGGAACTTTCAACTGCTCGTTTGCTCGCGAATACAGAGCCCGGAGGTGGAGTTCTAGATCCTCGCGAATACCAA
ATCGAGCTCTTTGAAAGAGCACGGGCTAGCAACACGATCGCGGTTCTCGACACAGGGTCTGGGAAGACTTTAGTG
GCCGTGCTTTTGCTCAAGCATATTCTCCAAATCGAACTCAACAAACGTGCAAATGGCGCAAGTCCTCGCGTTGCC
TTTTTCCTGGTCGACAGTGTGACTTTGGTTTTTCAACAGTCTGCGGTATTGAGAAACAATCTCGATCAAAGAGTC
GCTCATTTTTATGGCAATCTGGGACCCGATCTTTGGGACCAACAGACGTGGAACAAGCATCTTGAAAAGTACATG
GTGATTGTATGCACGGCGGAGATTCTAAACCAATCTCTACTGAATGGCCATATAAGAATTGACCAGATCAATCTT
CTGATCTTCGACGAAGCTCACCATGCCAAGAAGGAGCATCCGTATGCTCGGTATGCAGCCCATTTTTCAATTGTA
ACATGATGACAAGAGCTGACATTTATTAGTATCATCCGAGACAGCTATCTGAAAGCGGATCCTGAAAAGCGCCCA
AGGATCTTCGGGATGACCGCTTCCCCGGTTGATGCTAAGTGTGACATAGCGGAAGCAGCAATGTGAGCACCCTAA
CTAACCGAAATTGGAAGCTTTTGCTGACTGTATATAGCCAACTTGAGACTCTTTTAGATAGTCGCATTGCAACAA
CCTCAGATCTTACCCTCCTGCGGAATTTCGTGAACAAGCCAATGGAAGAGGAATGGGTCTACGACAAGCTTCCTC
CGCCGTTTGAGACCAATCTACATGGTACTTTGAAAGTCAAGTATGGTGATATGCCAATACTAGAGGGCGCATTTC
GATTTGCATCGGTTGCAAGCTCGGAATTAGGGGCTTGGTGCGCAGACCAGGTATGGGCCTTGGCCCTGGCTGACG
AAGTGCTGCCCAAGCTGGAGGGTAGTATCGGCAAAGTCACCGATTCTGATCCCCAGGATTCTGAAAAGGCCTCAG
AGGACATTAAGCGGATCCAAGAAGCCAACCAGCTCGTCAAGGAATACATTGAAAACCAGGCATTTACGCCGGCTG
ATCTCAGCTCCAAAGTAGAGCTTTTAATGAGAAAGTTGCAAGAACAGTTTGCGAAGTCGCCAGATACCAAATGCA
TTGTGTTCACACAACGGCGCAATACAGCTAAAATAATGTTACAGCTGTGCGAAAAGCTGCAACTCCCAAACCTCC
GTCCCGATGCTTTGGTTGGTGTTCGCAAAGGAGATGCTCTAGGAATGAATTCCACGTTTCGTCGGCAGTTTCTTG
TCTTGGTCAAGTTCCGAAAAAGTGAAGTCAACTGCTTGGTGAGCTTTTACACGACCCGAAAAAACAACTTATAGA
GAAAGTCTAATCATTTCCAGTTTGCAACATCGGTCGCAGAGGAAGGCCTTGACATCCCAGATTGTAATCTGGTGG
TAAGGTATGTCATTCACCATTCTAATCACAACTGTTACTTTTACTGACTAGCAAAGATTCGATCTGTTTGACACG
GTAATTCAATATGTCCAAAGCCGAGGCCGTGCCAGAAGCGCTGATTCAGTGGTTAGATTTCCTTCCCCTTTATGA
GACGCAACTGATTTACTCACTACTCTGCAGTACGCAACTATGGTCGAAAGTGGCAATCACAACCACAGCATGAGA
CTACAGGAAGTTCGAAGAGCAGAGGTAAGGGTGCTTCGCAGGTAATAGAGCACTGAACTAACTGACATAAACAGC
ACCTCATGAAGAATTTCTGCAATCTGCTGCCGGAGGATCGAAAATTGTACGGAGCCGATCACGATACGAAAGGGC
TTATTCACGAGGAAGATAGGAAGAGAACATACACCATCCCGAACACAGGTGCCATGTTAACCTGTCGCCATGCGA
TTGGTGTATTGGCACGATTTGCCAGCTCATTGGTAAGAATCAGTTTGCCTCTGATGGCTTTCATCAAAGCTAACG
CTGACCAAATTCTAGCAATACGAAAATGAGATATCAGCATCGGTCACATACATTGTGATGTCAGAGAACGAATCA
TTCAGCTGTGAGATAATTATGCCGGAGAAGTCGCCTGTGCGAAGAGTGATTGGACGTTCCGAATCGAAGAAATCA
CTCGCCAAGCAGTCCGCTGCTTTTGATGCGTGTATGCTGCTTCGCCAAAAGAATCTGTTGGATGAGCACTTCAAC
TCTATCTACCACAAGCGCTTGCCAGCAATGCGCAATGCCAAACTGGCTATTACTTCAAAGAGGACTGATCAGTAC
CGAATGCGTACTAAGCCCTCAATCTGGGCTAGGCTGCAGGGAACCGTTCCCACACGCCTCTACGCGATAGTTATT
CGTCTCATTCCATCAAAGCCTCTGGCTCGAGCTCATGGAAGTATTGTATTGCTTACACGAGAGCGAATCACTACA
ATTCCGACTTTCCCGGTCTTCTTGGATAAGGATATCGAGACTACAGTTCAGTCTTTGTGTATTGACGACGGCCTC
GAGGTTGCTTCCAAAGATCTCGAATATCTGACTGTATTTACACTTGCTGTCTTTCATGACGTGTTTCACAAGACC
TATAAGCACGTCTCGGAACAGTTTCCATACTGGCTTGCGCCTGCTCGAGAAGATGTCGACATTGGAACGTCAACA
AGTATCTTTGACATAATTGACTGGGAGGCTTTACAATATGTCCGAGATAACCCCAAGCTTATGTGGTCTTCTGAC
ATGGAGCCAGAATCGTTGCTGACTCGATTCATCTACGACGATTGGAATGGAAAGTATCGATACTTCCCGCTTGCT
ATAGACCCCAATCTACGTCCTTCAGACCCACCCCCATCCTACGCACCATCTCGAAAATGGTCAGACAATATCATG
AATTGGTCCTTGAGTTTGAGCAAAAATTCACGTCCCAAATTCTTCAACCGATGTATCTGGACCCAACCGGTCTTC
CAGGCGGAGTTGATCTGCCTTCGGCGGAACTTCCTTGATAAAGCGGCCGAGGAAGAGAAAGCATCCAACTCGAGA
TGTGTCATTTGCCCTCAGCCCTTGGCTATATCGGCGGTTAGTTCTTCACCAGTATACGTTTCAGTTTATCCAATA
TGCTAACATGTAACTCAGATTTCCACGTCTGTGGCCGCGACGTGTTTTGTCTTTCCAGCAATTATCACGCGAATG
GAATCCTACCTGATCGCCCAGGAGGGATGCAATATGCTAGGTCTTGGTGGCATTAAGCTCGAGTATGCCCTGGAG
GCCTTCACCAAGGATTCAGACAACACCGAAGAGCATCGGAGCCTACAGATTCACGTTCAACGAGGAATGGGGAAA
AATTACGAGCGCCTTGAACTACTAGGGGACTCTGTGCTCAAGATGGCAACATCCATTTCGCTCTTTATTCAAAAT
CCGGAGGATGATGAATACGACTACCACGTTAACAGAATGTGTCTCATCTGCAACAAGAACCTGTTCAGAAACGCA
ATTGAACTGAAACTCTATGAGTACATACGTAGCCGTGGGTTCTCTCGGTATGTTCTTTACATTTTGTCCCAACAA
TTGTGTGTTTTACTGACACTTAATCACAGACATATGTGGTACCCCCCAGGTCTTTCGCTCGAGTATGGTCGGGAC
CACGCCAAGTTTTTTGCCAGTGAAGGTAAGCACTCCTTGGCTGAGAAGACTATAGCAGATGTCTGCGAGGCATTG
ATAGGAGCATCGTTGCTCTCGGGAGGTGATGACAATCGGTATGATATGGCTATCAAAGCTGTCACCGTCTTCGTC
AACAGTCATAACCACACGGCAACCTCATGGGAAGACTACCTCTCAGCATATTCCATGCCTTTGTATCAGAACAGG
GCAGCGGATGGATTTGAAAAGAACCTGGCCCAGCAAATCTTCGAGAAAGTAGGCTACGAGTTCAAGTACCCTCGT
CTCCTGCGGTCGGCTTTCACGCATCCATCTTATCCATTGGCATGGGCTAAGGTGCCTTGTTATCAGAGGCTCGAG
TTCTTGGGTGATGCACTCCTGGATATGGTGTGCGTGGAGCACTTGTTTCATCGGTTCCCCAACCGAGATCCGCAG
TGGTTGACTGAACACAAGGTCCGTAAATTTTTTTTTTCACAATGTCAAGCCACAAGCAAGTGCCGACTAACATGA
ATAGATGGCTATGGTATCCAACAAATTTCTTGGTGCTTTGGCTGTAAAACTGGGGCTTCATGTTCATCTTCAGCA
TTTCAGCAATCCTCTCATGATCCAAAACAACAAATACGCAGAGGAAATTCAGCTTGCAGAGAGCGAAGGCAACGG
AGAGGTCGACTACTGGCTTTCGACGTCAGATTCCCCAAAGGTAAGTTCCTTATTTGACATGGACACAATCCACAT
GCTCACGAATTACAGTGTCTTCCCGACATGCTTGAGGCTTATCTGGGTGCTATATTTGTTGATTCTGGCTTCGAC
TTCACAGTTATTGAAGCCTTCTTCAACATGCATATCCTACCATTTTTCCACGACATGTCTATTTACGACACATTT
GCAAACAGACATCCAACGGTAAGACCATCTCCTGCCCCTGAGATTATATGCTTTATGCTAATAGGTCATAGACAT
TCCTTCATAGCCAAATGACTCACAGCTACCAATGCACCGATTACTGCTTGAAATCTGCAGAGGTCCCTGCCGTGG
AAGGGGAGACCCCCAGGGTCTTTGCTGCGGTTATGGTGCACGGCCAATCCATTGCCAGCGCAGTCGCATCTTCTA
GTCGGTATGCTAAAGTGAGGGCTAGTACCCGGGCATTGGCTGTTATTGATGGAATGTCTCTTTCCGAGTTCCGAG
AGAAATATCACTGTGCTTGTCAAGGTGGACAAGCCACCGTGGACCGCGCAAGTATCGGAACGGCAATTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail