Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g1588.t1
Gene name
Locationscaffold_02:355444..356922
Strand+
Gene length (bp)1478
Transcript length (bp)1227
Coding sequence length (bp)1227
Protein length (aa) 409

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00956 NAP Nucleosome assembly protein (NAP) 1.8E-98 88 345

GO

GO Term Description Terminal node
GO:0005634 nucleus Yes
GO:0006334 nucleosome assembly Yes
GO:0043933 protein-containing complex organization No
GO:0071824 protein-DNA complex subunit organization No
GO:0008150 biological_process No
GO:0005575 cellular_component No
GO:0065003 protein-containing complex assembly No
GO:0016043 cellular component organization No
GO:0065004 protein-DNA complex assembly No
GO:0043227 membrane-bounded organelle No
GO:0071840 cellular component organization or biogenesis No
GO:0043229 intracellular organelle No
GO:0034728 nucleosome organization No
GO:0043231 intracellular membrane-bounded organelle No
GO:0006325 chromatin organization No
GO:0022607 cellular component assembly No
GO:0110165 cellular anatomical entity No
GO:0043226 organelle No
GO:0006338 chromatin remodeling No
GO:0009987 cellular process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 70 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 328.43 195.12 461.74
5d_25C Five days - 25 degrees Celsius 283.40 169.73 397.07
7d_25C Seven days - 25 degrees Celsius 288.11 171.92 404.30
10d_25C Ten days - 25 degrees Celsius 337.06 200.18 473.94
7d_15C Seven days - 15 degrees Celsius 252.48 150.49 354.46
7d_30C Seven days - 30 degrees Celsius 299.90 178.86 420.95

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.586703 no
3d_25C 7d_25C 0.642161 no
3d_25C 7d_15C 0.274852 no
3d_25C 7d_30C 0.766204 no
3d_25C 10d_25C 0.938696 no
5d_25C 7d_25C 0.964552 no
5d_25C 7d_15C 0.688080 no
5d_25C 7d_30C 0.863587 no
5d_25C 10d_25C 0.504285 no
7d_25C 7d_15C 0.644420 no
7d_25C 7d_30C 0.907191 no
7d_25C 10d_25C 0.566127 no
7d_15C 7d_30C 0.520000 no
7d_15C 10d_25C 0.219039 no
7d_30C 10d_25C 0.690279 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g1588.t1
MSEPIRNKKADFPVAPTPQNTPANNAPISSHAQQPGVSSIEEETFDKATAASLFARNPALVSMIQGKLGQLVGRS
SGYIESLPPSVRRRVAGLKGIQKEHSKLEAQFQEEVLELEKKYFGKFTPLYQRRSTIINGGIEPTEAEVEAGKED
EESDEEETKEEPKKEEGEAAKGIPEFWLSAMKNQISLAEMITERDEEALKHLTDIRMEYLDRPGFRLIFEFSENE
FFTNKTISKSYFYKDESGYGGDFIYDHADGSQIDWKEDQDLTLRLESKKQRNKNTKQTRVVKISVPTESFFNFFS
PPQPPAEDDDSVASDIEERLELDYQLGEDIKEKLIPRAIDWFTGEALQFEELGEDLEGDEFEDDDDEDEDEDEDE
EELGSDREVDEEDTDEEDGTSKPKKEAAECKQN*
Coding >Pro_DTO377G3_2|g1588.t1
ATGTCTGAGCCCATCAGAAATAAGAAGGCGGACTTCCCGGTCGCACCGACCCCGCAAAACACGCCGGCCAACAAT
GCTCCTATCTCATCTCACGCCCAGCAGCCTGGTGTATCCAGCATCGAGGAGGAAACCTTTGACAAAGCTACGGCT
GCCTCGCTCTTTGCTCGCAACCCTGCTTTGGTATCCATGATCCAAGGCAAGTTGGGTCAACTCGTCGGCCGCTCG
TCAGGCTACATCGAATCTCTCCCCCCCTCCGTCCGCCGCCGTGTCGCTGGATTGAAGGGTATCCAGAAGGAGCAC
TCCAAGCTCGAGGCCCAGTTCCAAGAGGAGGTTCTGGAACTTGAGAAGAAGTACTTCGGCAAGTTCACGCCCCTG
TACCAGCGTCGTTCTACTATTATCAACGGCGGCATCGAGCCGACCGAGGCCGAGGTTGAGGCCGGAAAGGAGGAC
GAGGAGAGTGATGAGGAGGAGACTAAGGAGGAGCCCAAGAAGGAGGAGGGCGAGGCCGCGAAGGGCATCCCCGAA
TTCTGGCTTTCTGCCATGAAGAACCAAATCTCGCTGGCTGAGATGATCACCGAGCGCGATGAGGAGGCTCTCAAG
CACCTCACCGACATTCGCATGGAGTACCTTGACCGACCCGGATTCCGCCTCATTTTCGAGTTCTCTGAGAACGAG
TTCTTCACCAACAAAACTATCTCCAAGTCATACTTCTACAAGGATGAGAGTGGATACGGTGGCGATTTCATTTAC
GACCACGCCGATGGATCCCAGATTGACTGGAAGGAGGACCAAGACCTGACCCTCCGCCTGGAGAGCAAGAAGCAG
CGCAACAAGAACACCAAGCAGACCCGCGTTGTTAAGATCAGTGTGCCTACCGAGTCCTTCTTCAACTTCTTCTCA
CCCCCACAGCCACCTGCCGAGGATGACGATTCAGTCGCCAGCGACATTGAAGAGCGTCTGGAGCTTGATTATCAG
CTCGGTGAGGATATTAAGGAGAAGCTCATTCCCCGTGCCATTGACTGGTTCACCGGTGAAGCTCTCCAGTTCGAG
GAGCTCGGTGAGGATCTGGAGGGTGATGAGTTTGAGGATGACGATGACGAGGATGAGGATGAAGATGAGGACGAG
GAGGAGCTCGGGTCAGACCGTGAAGTGGACGAGGAGGACACAGACGAAGAGGATGGTACTTCCAAGCCCAAGAAG
GAGGCCGCCGAGTGCAAGCAAAACTAA
Transcript >Pro_DTO377G3_2|g1588.t1
ATGTCTGAGCCCATCAGAAATAAGAAGGCGGACTTCCCGGTCGCACCGACCCCGCAAAACACGCCGGCCAACAAT
GCTCCTATCTCATCTCACGCCCAGCAGCCTGGTGTATCCAGCATCGAGGAGGAAACCTTTGACAAAGCTACGGCT
GCCTCGCTCTTTGCTCGCAACCCTGCTTTGGTATCCATGATCCAAGGCAAGTTGGGTCAACTCGTCGGCCGCTCG
TCAGGCTACATCGAATCTCTCCCCCCCTCCGTCCGCCGCCGTGTCGCTGGATTGAAGGGTATCCAGAAGGAGCAC
TCCAAGCTCGAGGCCCAGTTCCAAGAGGAGGTTCTGGAACTTGAGAAGAAGTACTTCGGCAAGTTCACGCCCCTG
TACCAGCGTCGTTCTACTATTATCAACGGCGGCATCGAGCCGACCGAGGCCGAGGTTGAGGCCGGAAAGGAGGAC
GAGGAGAGTGATGAGGAGGAGACTAAGGAGGAGCCCAAGAAGGAGGAGGGCGAGGCCGCGAAGGGCATCCCCGAA
TTCTGGCTTTCTGCCATGAAGAACCAAATCTCGCTGGCTGAGATGATCACCGAGCGCGATGAGGAGGCTCTCAAG
CACCTCACCGACATTCGCATGGAGTACCTTGACCGACCCGGATTCCGCCTCATTTTCGAGTTCTCTGAGAACGAG
TTCTTCACCAACAAAACTATCTCCAAGTCATACTTCTACAAGGATGAGAGTGGATACGGTGGCGATTTCATTTAC
GACCACGCCGATGGATCCCAGATTGACTGGAAGGAGGACCAAGACCTGACCCTCCGCCTGGAGAGCAAGAAGCAG
CGCAACAAGAACACCAAGCAGACCCGCGTTGTTAAGATCAGTGTGCCTACCGAGTCCTTCTTCAACTTCTTCTCA
CCCCCACAGCCACCTGCCGAGGATGACGATTCAGTCGCCAGCGACATTGAAGAGCGTCTGGAGCTTGATTATCAG
CTCGGTGAGGATATTAAGGAGAAGCTCATTCCCCGTGCCATTGACTGGTTCACCGGTGAAGCTCTCCAGTTCGAG
GAGCTCGGTGAGGATCTGGAGGGTGATGAGTTTGAGGATGACGATGACGAGGATGAGGATGAAGATGAGGACGAG
GAGGAGCTCGGGTCAGACCGTGAAGTGGACGAGGAGGACACAGACGAAGAGGATGGTACTTCCAAGCCCAAGAAG
GAGGCCGCCGAGTGCAAGCAAAACTAA
Gene >Pro_DTO377G3_2|g1588.t1
ATGTCTGAGCCCATCAGAAATAAGAAGGCGGACTTCCCGGTCGCACCGTAAGCATCCCCCCTCCTCCCGTTTTTT
TTTCCCACCCTTATCAAAAGCAAAAAAAAAAAACATGGATGCTGACTTGCAGAAGGACCCCGCAAAACACGCCGG
CCAACAATGCTCCTATCTCATCTCACGCCCAGCAGCCTGGTGTATCCAGCATCGAGGAGGGTAAGTCATCTCTTT
TCTCGTATTCACCGACATTTCTTTGACCGTGCTTTCTGTTCTAGAAACCTTTGACAAAGCTACGGCTGCCTCGCT
CTTTGCTCGCAACCCTGCTTTGGTATCCATGATCCAAGGCAAGTTGGGTCAACTCGTCGGCCGCTCGTCAGGCTA
CATCGAATCTCTCCCCCCCTCCGTCCGCCGCCGTGTCGCTGGATTGAAGGGTATCCAGAAGGAGCACTCCAAGCT
CGAGGCCCAGTTCCAAGAGGAGGTTCTGGAACTTGAGAAGAAGTACTTCGGCAAGTTCACGCCCCTGTACCAGCG
TCGTTCTACTATTATCAACGGCGGCATCGAGCCGACCGAGGCCGAGGTTGAGGCCGGAAAGGAGGACGAGGAGAG
TGATGAGGAGGAGACTAAGGAGGAGCCCAAGAAGGAGGAGGGCGAGGCCGCGAAGGGCATCCCCGAATTCTGGCT
TTCTGCCATGAAGAACCAAATCTCGCTGGCTGAGATGATCACCGAGCGCGATGAGGAGGCTCTCAAGCACCTCAC
CGACATTCGCATGGAGTACCTTGACCGACCCGGATTCCGCCTCATTTTCGAGTTCTCTGAGAACGAGTTCTTCAC
CAACAAAACTATCTCCAAGTCATACTTCTACAAGGATGAGAGTGGATACGGTGGCGATTTCATTTACGACCACGC
CGATGGATCCCAGATTGACTGGAAGGAGGACCAAGACCTGACCCTCCGCCTGGAGAGCAAGAAGCAGCGCAACAA
GAGTAAGTCCACTCGAATATTGAGATGCCATGTTGAAACTGACAGCTGACGCTCCTTTAGACACCAAGCAGACCC
GCGTTGTTAAGATCAGTGTGCCTACCGAGTCCTTCTTCAACTTCTTCTCACCCCCACAGCCACCTGCCGAGGATG
ACGATTCAGTCGCCAGCGACATTGAAGAGCGTCTGGAGCTTGATTATCAGCTCGGTGAGGATATTAAGGAGAAGC
TCATTCCCCGTGCCATTGACTGGTTCACCGGTGAAGCTCTCCAGTTCGAGGAGCTCGGTGAGGATCTGGAGGGTG
ATGAGTTTGAGGATGACGATGACGAGGATGAGGATGAAGATGAGGACGAGGAGGAGCTCGGGTCAGACCGTGAAG
TGGACGAGGAGGACACAGACGAAGAGGTATGGCATACCACACTCACCGACTCAGATCACTTGCTAACTTCGTTCC
AGGATGGTACTTCCAAGCCCAAGAAGGAGGCCGCCGAGTGCAAGCAAAACTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail