Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g1587.t1
Gene name
Locationscaffold_02:349341..354313
Strand-
Gene length (bp)4972
Transcript length (bp)3939
Coding sequence length (bp)3939
Protein length (aa) 1313

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12409 P5-ATPase P5-type ATPase cation transporter 8.7E-38 162 278
PF00122 E1-E2_ATPase E1-E2 ATPase 2.7E-32 395 604

GO

GO Term Description Terminal node
GO:0019829 ATPase-coupled cation transmembrane transporter activity Yes
GO:0006812 cation transport Yes
GO:0016021 integral component of membrane Yes
GO:0140358 P-type transmembrane transporter activity Yes
GO:0008324 cation transmembrane transporter activity No
GO:0006810 transport No
GO:0008150 biological_process No
GO:0140657 ATP-dependent activity No
GO:0015399 primary active transmembrane transporter activity No
GO:0005575 cellular_component No
GO:0022857 transmembrane transporter activity No
GO:0051234 establishment of localization No
GO:0022804 active transmembrane transporter activity No
GO:0022853 active ion transmembrane transporter activity No
GO:0003674 molecular_function No
GO:0022890 inorganic cation transmembrane transporter activity No
GO:0006811 ion transport No
GO:0042626 ATPase-coupled transmembrane transporter activity No
GO:0015075 ion transmembrane transporter activity No
GO:0051179 localization No
GO:0031224 intrinsic component of membrane No
GO:0015318 inorganic molecular entity transmembrane transporter activity No
GO:0005215 transporter activity No
GO:0110165 cellular anatomical entity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 177 199 22
2 357 379 22
3 541 563 22
4 570 592 22
5 1098 1120 22
6 1141 1163 22
7 1188 1210 22
8 1217 1239 22
9 1254 1273 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g1587.t1
MPRPHSPSGTGPVDLSMPRNRMRRDSMRSSVSAVSDVEMARNEVFDGPISESIPSSVASFAHRRNRAGSTVSFTY
FQDGEDFAELSNESAVDEQSELDEESLHGIGDADVESVRGSFVSKRMSTSRDSVEHPLLSRYLSASSYGRDRRSG
SRLNQKVYLASEDLTAVFAGFSTSSGGFAVYIALCILTGGFAWLLFRWLPRWRVKLVGKATPLGKCQWVAIEDQW
NQFTIHKVGSQPYGRPLSTVFADSLNHTYDEDNDPTITSLHFIDYRYLKFFYHPIEDKFCLISGWKDPSWTNAKV
MRSGLDADERDSREQIFGSNDIEIDAKTIPQLLVDEAFHPFYIFQIASLVLWSMDEYYYYAVCIFLISFFSIATT
VLETKSTMSRLREISLFECDVRVLRSGFWRSVSSQELVPGDVYEFSDPSLHQVPCDCILLSGDCIVNESMLTGES
VPVSKTPLTDDAIQYLDLSTPSIHPHVAKHFLFSGTKVIRARRPQNVDDDEAVALAIVMRTGFSTTKGALVRSML
FPKPSGFKFYRDSFRYIAVMGIVALIGFVASFINFVRLGLAWHLIIIRALDLITIVVPPALPATLTIGTNFALSR
LKKQNIFCISPQKVNVGGKLDIVCFDKTGTLTEDGLDVLGMRIVTRANRFSDLLSETNDGFLRPSPDANSEYDIK
KQRKIMYAMATCHSLRVVDNELLGDPLDVKMFQFTNWTFEEGGDHISDQTSPKYDTIAPSVAKPPQGQTNGDVNN
PLELGVLRSFEFVSNLRRASVVVRKFGDNGASFFVKGAPESIMDICIPGTLPSDYEDLLNYYTHKGYRVIACASK
YEPKLSWRKVQKMSRTEAESDLEFLGFIIFENKLKPSTAGVISELNEAGIRNVMCTGDNILTAISVARECNMLGR
DELCFIPHFIESPGLAPKASLIWECVDNSDLRLDPRTLLPLNDAEVDMSIPGNVFTEREYSVAVTGDAFRWLVDF
GNEDVLNKVLVCGKVFARMSPDEKHELVEKLQSIDYCCGFCGDGANDCGALKAADVGISLSDAEASVAAPFTSRV
FEISCVPTVIREGRAALVTSFSCFKFMSLYSAIQFSSVSFLYTSGSNLGDFQFLFIDLLLIMPIAVFMGWADPAP
TMSRKRPTADLVSRKVLTPLLGQILLVVLSQFAVFQTVQLQPWFLPPQLDKEKSNILNSENTSLFLFSCFQYIFI
SIVLSAGPPFRKPMTQNVPYLCTIIVNILVSGYMLFRPSNWVSEVMQLTFMSDGFKSWLLALAFGIFVLSWTAEK
TIFPRVAQILGHTRARLQQNYRKKRKMYKVLLEGLRL*
Coding >Pro_DTO377G3_2|g1587.t1
ATGCCCCGTCCGCACTCTCCCTCGGGGACTGGTCCTGTGGACCTATCTATGCCTCGAAACAGAATGCGACGCGAT
TCCATGCGAAGCAGTGTGAGCGCCGTGTCGGATGTGGAGATGGCCCGTAATGAGGTCTTCGATGGCCCGATCTCG
GAAAGCATCCCTTCAAGCGTCGCCTCGTTCGCGCACCGCCGTAACCGAGCAGGCTCTACGGTGAGCTTTACATAC
TTCCAGGACGGGGAAGACTTCGCAGAATTGTCGAACGAATCTGCAGTGGACGAGCAAAGCGAGCTTGATGAAGAA
TCTTTACACGGCATTGGGGATGCAGATGTTGAGTCAGTCAGGGGATCCTTTGTGTCTAAGCGGATGTCTACCTCC
CGCGACTCGGTTGAACATCCACTTCTTTCTCGCTACCTGTCCGCCAGCTCATATGGCCGAGACCGACGATCCGGC
AGTCGGTTGAATCAAAAAGTCTATCTCGCCTCGGAAGATTTGACGGCTGTCTTTGCTGGGTTCTCCACGAGTTCA
GGAGGGTTTGCTGTCTATATTGCCCTTTGCATCTTGACCGGTGGATTTGCCTGGCTTCTCTTCCGATGGCTGCCA
CGATGGCGGGTAAAGTTAGTTGGGAAGGCAACCCCATTAGGAAAATGCCAATGGGTGGCTATTGAGGACCAATGG
AACCAATTCACCATCCACAAAGTTGGCAGCCAGCCTTATGGACGTCCGCTTTCCACGGTCTTCGCCGACTCACTG
AATCACACCTACGATGAAGATAATGACCCGACTATTACCTCTCTGCACTTCATCGACTATCGATATCTGAAGTTC
TTCTATCATCCAATCGAGGATAAATTTTGCTTGATAAGCGGCTGGAAAGATCCTTCGTGGACTAATGCCAAAGTC
ATGCGAAGTGGATTAGATGCCGATGAACGAGACAGCAGGGAACAGATATTCGGAAGTAACGACATCGAAATTGAT
GCAAAGACAATTCCTCAGCTTCTCGTCGACGAGGCATTTCATCCTTTTTATATCTTCCAGATTGCAAGTCTCGTT
CTGTGGTCCATGGATGAGTACTACTACTACGCCGTCTGTATCTTTCTTATATCGTTTTTCAGCATAGCAACGACT
GTGCTAGAGACGAAATCAACTATGAGTCGGCTCAGGGAGATATCTCTTTTCGAGTGTGATGTTCGCGTTCTAAGA
AGTGGATTCTGGCGGTCCGTTTCCTCCCAAGAACTAGTTCCTGGTGATGTTTATGAATTTTCCGACCCATCGCTT
CACCAGGTCCCGTGTGACTGTATCTTGTTGTCAGGTGACTGCATTGTGAATGAGAGCATGCTCACTGGTGAATCC
GTCCCTGTGTCTAAAACACCACTCACCGATGACGCCATCCAATATCTCGATCTCAGTACCCCTTCTATCCACCCC
CATGTTGCTAAACACTTCCTCTTCAGCGGAACCAAAGTAATCCGGGCTAGACGACCCCAGAATGTTGATGACGAT
GAAGCAGTAGCATTGGCAATTGTCATGAGAACTGGCTTTTCGACAACCAAGGGGGCTCTAGTTCGATCGATGCTT
TTTCCGAAACCCTCTGGATTCAAGTTCTACCGAGACTCGTTCCGCTACATCGCCGTGATGGGGATTGTCGCTCTC
ATCGGATTCGTTGCTTCATTCATTAACTTTGTTCGATTGGGTCTCGCTTGGCATCTGATCATAATTCGAGCCCTC
GATCTGATCACGATTGTTGTACCGCCAGCTCTCCCAGCCACACTCACCATCGGAACCAATTTTGCACTTTCACGA
CTGAAGAAACAGAACATATTCTGTATCAGCCCACAGAAGGTCAACGTGGGAGGAAAGCTGGACATTGTTTGTTTT
GATAAAACAGGAACCCTCACAGAAGACGGACTGGATGTCCTAGGAATGCGTATAGTCACCCGTGCCAATAGATTT
TCAGACTTGCTCTCTGAGACGAATGACGGGTTTCTTCGTCCTTCCCCCGATGCTAACTCCGAATACGATATCAAA
AAGCAAAGGAAGATCATGTACGCCATGGCTACGTGTCATTCCCTTAGGGTAGTGGACAATGAGCTGTTGGGAGAT
CCTCTCGATGTCAAGATGTTTCAATTTACCAACTGGACGTTTGAGGAGGGAGGGGATCATATTTCTGACCAGACA
AGCCCCAAATATGACACTATAGCGCCGTCAGTTGCAAAGCCTCCTCAAGGACAGACTAATGGTGATGTAAATAAC
CCACTCGAGCTTGGAGTTCTGCGGAGTTTCGAATTTGTCTCCAATCTTCGCCGCGCAAGTGTCGTTGTCAGGAAA
TTTGGCGACAACGGAGCAAGTTTCTTTGTCAAGGGTGCTCCAGAAAGCATTATGGACATATGTATTCCTGGAACT
CTTCCTTCGGATTATGAAGATCTCCTGAATTACTACACTCACAAGGGATACCGTGTGATTGCCTGTGCTTCCAAA
TATGAACCAAAATTGAGCTGGAGAAAAGTCCAAAAAATGTCTCGGACGGAAGCCGAATCTGACCTGGAATTCTTG
GGTTTCATCATATTCGAGAATAAGTTGAAGCCCAGTACTGCCGGTGTGATTTCCGAGTTGAACGAGGCGGGGATT
CGCAATGTAATGTGCACCGGTGATAACATCTTGACTGCCATCAGTGTTGCTCGTGAATGCAACATGCTTGGACGT
GATGAGCTATGCTTTATCCCGCACTTTATCGAATCGCCTGGTCTTGCACCTAAAGCTTCTCTCATATGGGAATGC
GTGGACAACTCCGACCTCCGCTTGGACCCAAGAACACTCTTGCCACTCAACGACGCGGAGGTCGACATGTCAATT
CCAGGAAACGTTTTCACCGAGCGTGAATACTCTGTTGCTGTCACGGGTGATGCCTTTAGATGGTTGGTTGACTTC
GGGAATGAAGATGTACTCAACAAGGTACTTGTATGCGGCAAAGTGTTTGCCCGTATGTCCCCGGACGAGAAGCAC
GAACTAGTTGAGAAACTTCAGTCTATTGATTACTGCTGTGGCTTTTGCGGCGATGGTGCCAATGATTGTGGCGCT
CTGAAGGCCGCAGATGTTGGTATTTCACTGTCGGACGCCGAGGCGTCCGTTGCCGCACCCTTTACTAGCCGCGTG
TTCGAAATCTCTTGTGTTCCGACGGTGATCAGGGAAGGTCGAGCTGCGCTGGTGACAAGTTTCTCCTGTTTCAAG
TTCATGAGTCTTTATTCCGCCATTCAATTCTCCTCGGTCAGCTTCCTGTACACGTCGGGGTCAAATCTTGGTGAT
TTCCAGTTCCTCTTTATCGATCTTCTGCTCATTATGCCCATTGCGGTCTTCATGGGCTGGGCTGATCCTGCTCCC
ACGATGTCTCGGAAACGGCCAACTGCTGATCTTGTTTCCCGTAAGGTATTGACACCTTTGCTCGGGCAGATCTTG
CTAGTTGTGCTGTCGCAATTTGCAGTTTTCCAGACCGTTCAATTACAGCCATGGTTCTTGCCGCCACAATTGGAC
AAAGAAAAGAGCAACATTCTCAATTCAGAGAATACTTCTTTGTTCTTGTTTTCCTGTTTCCAGTACATCTTCATC
AGCATTGTTCTGAGTGCGGGTCCGCCATTCCGGAAACCAATGACTCAGAATGTGCCGTACTTATGTACGATCATC
GTCAACATCTTGGTCTCGGGCTATATGCTCTTTAGACCATCTAACTGGGTGTCGGAGGTGATGCAACTGACTTTC
ATGTCTGATGGTTTCAAGTCCTGGCTACTTGCGCTAGCATTCGGAATCTTCGTTTTGTCCTGGACAGCAGAGAAG
ACCATATTCCCTCGCGTGGCACAGATACTTGGACATACTCGTGCCCGCTTGCAGCAAAACTACCGCAAGAAGCGC
AAGATGTACAAAGTGCTGTTGGAGGGACTGCGCCTATGA
Transcript >Pro_DTO377G3_2|g1587.t1
ATGCCCCGTCCGCACTCTCCCTCGGGGACTGGTCCTGTGGACCTATCTATGCCTCGAAACAGAATGCGACGCGAT
TCCATGCGAAGCAGTGTGAGCGCCGTGTCGGATGTGGAGATGGCCCGTAATGAGGTCTTCGATGGCCCGATCTCG
GAAAGCATCCCTTCAAGCGTCGCCTCGTTCGCGCACCGCCGTAACCGAGCAGGCTCTACGGTGAGCTTTACATAC
TTCCAGGACGGGGAAGACTTCGCAGAATTGTCGAACGAATCTGCAGTGGACGAGCAAAGCGAGCTTGATGAAGAA
TCTTTACACGGCATTGGGGATGCAGATGTTGAGTCAGTCAGGGGATCCTTTGTGTCTAAGCGGATGTCTACCTCC
CGCGACTCGGTTGAACATCCACTTCTTTCTCGCTACCTGTCCGCCAGCTCATATGGCCGAGACCGACGATCCGGC
AGTCGGTTGAATCAAAAAGTCTATCTCGCCTCGGAAGATTTGACGGCTGTCTTTGCTGGGTTCTCCACGAGTTCA
GGAGGGTTTGCTGTCTATATTGCCCTTTGCATCTTGACCGGTGGATTTGCCTGGCTTCTCTTCCGATGGCTGCCA
CGATGGCGGGTAAAGTTAGTTGGGAAGGCAACCCCATTAGGAAAATGCCAATGGGTGGCTATTGAGGACCAATGG
AACCAATTCACCATCCACAAAGTTGGCAGCCAGCCTTATGGACGTCCGCTTTCCACGGTCTTCGCCGACTCACTG
AATCACACCTACGATGAAGATAATGACCCGACTATTACCTCTCTGCACTTCATCGACTATCGATATCTGAAGTTC
TTCTATCATCCAATCGAGGATAAATTTTGCTTGATAAGCGGCTGGAAAGATCCTTCGTGGACTAATGCCAAAGTC
ATGCGAAGTGGATTAGATGCCGATGAACGAGACAGCAGGGAACAGATATTCGGAAGTAACGACATCGAAATTGAT
GCAAAGACAATTCCTCAGCTTCTCGTCGACGAGGCATTTCATCCTTTTTATATCTTCCAGATTGCAAGTCTCGTT
CTGTGGTCCATGGATGAGTACTACTACTACGCCGTCTGTATCTTTCTTATATCGTTTTTCAGCATAGCAACGACT
GTGCTAGAGACGAAATCAACTATGAGTCGGCTCAGGGAGATATCTCTTTTCGAGTGTGATGTTCGCGTTCTAAGA
AGTGGATTCTGGCGGTCCGTTTCCTCCCAAGAACTAGTTCCTGGTGATGTTTATGAATTTTCCGACCCATCGCTT
CACCAGGTCCCGTGTGACTGTATCTTGTTGTCAGGTGACTGCATTGTGAATGAGAGCATGCTCACTGGTGAATCC
GTCCCTGTGTCTAAAACACCACTCACCGATGACGCCATCCAATATCTCGATCTCAGTACCCCTTCTATCCACCCC
CATGTTGCTAAACACTTCCTCTTCAGCGGAACCAAAGTAATCCGGGCTAGACGACCCCAGAATGTTGATGACGAT
GAAGCAGTAGCATTGGCAATTGTCATGAGAACTGGCTTTTCGACAACCAAGGGGGCTCTAGTTCGATCGATGCTT
TTTCCGAAACCCTCTGGATTCAAGTTCTACCGAGACTCGTTCCGCTACATCGCCGTGATGGGGATTGTCGCTCTC
ATCGGATTCGTTGCTTCATTCATTAACTTTGTTCGATTGGGTCTCGCTTGGCATCTGATCATAATTCGAGCCCTC
GATCTGATCACGATTGTTGTACCGCCAGCTCTCCCAGCCACACTCACCATCGGAACCAATTTTGCACTTTCACGA
CTGAAGAAACAGAACATATTCTGTATCAGCCCACAGAAGGTCAACGTGGGAGGAAAGCTGGACATTGTTTGTTTT
GATAAAACAGGAACCCTCACAGAAGACGGACTGGATGTCCTAGGAATGCGTATAGTCACCCGTGCCAATAGATTT
TCAGACTTGCTCTCTGAGACGAATGACGGGTTTCTTCGTCCTTCCCCCGATGCTAACTCCGAATACGATATCAAA
AAGCAAAGGAAGATCATGTACGCCATGGCTACGTGTCATTCCCTTAGGGTAGTGGACAATGAGCTGTTGGGAGAT
CCTCTCGATGTCAAGATGTTTCAATTTACCAACTGGACGTTTGAGGAGGGAGGGGATCATATTTCTGACCAGACA
AGCCCCAAATATGACACTATAGCGCCGTCAGTTGCAAAGCCTCCTCAAGGACAGACTAATGGTGATGTAAATAAC
CCACTCGAGCTTGGAGTTCTGCGGAGTTTCGAATTTGTCTCCAATCTTCGCCGCGCAAGTGTCGTTGTCAGGAAA
TTTGGCGACAACGGAGCAAGTTTCTTTGTCAAGGGTGCTCCAGAAAGCATTATGGACATATGTATTCCTGGAACT
CTTCCTTCGGATTATGAAGATCTCCTGAATTACTACACTCACAAGGGATACCGTGTGATTGCCTGTGCTTCCAAA
TATGAACCAAAATTGAGCTGGAGAAAAGTCCAAAAAATGTCTCGGACGGAAGCCGAATCTGACCTGGAATTCTTG
GGTTTCATCATATTCGAGAATAAGTTGAAGCCCAGTACTGCCGGTGTGATTTCCGAGTTGAACGAGGCGGGGATT
CGCAATGTAATGTGCACCGGTGATAACATCTTGACTGCCATCAGTGTTGCTCGTGAATGCAACATGCTTGGACGT
GATGAGCTATGCTTTATCCCGCACTTTATCGAATCGCCTGGTCTTGCACCTAAAGCTTCTCTCATATGGGAATGC
GTGGACAACTCCGACCTCCGCTTGGACCCAAGAACACTCTTGCCACTCAACGACGCGGAGGTCGACATGTCAATT
CCAGGAAACGTTTTCACCGAGCGTGAATACTCTGTTGCTGTCACGGGTGATGCCTTTAGATGGTTGGTTGACTTC
GGGAATGAAGATGTACTCAACAAGGTACTTGTATGCGGCAAAGTGTTTGCCCGTATGTCCCCGGACGAGAAGCAC
GAACTAGTTGAGAAACTTCAGTCTATTGATTACTGCTGTGGCTTTTGCGGCGATGGTGCCAATGATTGTGGCGCT
CTGAAGGCCGCAGATGTTGGTATTTCACTGTCGGACGCCGAGGCGTCCGTTGCCGCACCCTTTACTAGCCGCGTG
TTCGAAATCTCTTGTGTTCCGACGGTGATCAGGGAAGGTCGAGCTGCGCTGGTGACAAGTTTCTCCTGTTTCAAG
TTCATGAGTCTTTATTCCGCCATTCAATTCTCCTCGGTCAGCTTCCTGTACACGTCGGGGTCAAATCTTGGTGAT
TTCCAGTTCCTCTTTATCGATCTTCTGCTCATTATGCCCATTGCGGTCTTCATGGGCTGGGCTGATCCTGCTCCC
ACGATGTCTCGGAAACGGCCAACTGCTGATCTTGTTTCCCGTAAGGTATTGACACCTTTGCTCGGGCAGATCTTG
CTAGTTGTGCTGTCGCAATTTGCAGTTTTCCAGACCGTTCAATTACAGCCATGGTTCTTGCCGCCACAATTGGAC
AAAGAAAAGAGCAACATTCTCAATTCAGAGAATACTTCTTTGTTCTTGTTTTCCTGTTTCCAGTACATCTTCATC
AGCATTGTTCTGAGTGCGGGTCCGCCATTCCGGAAACCAATGACTCAGAATGTGCCGTACTTATGTACGATCATC
GTCAACATCTTGGTCTCGGGCTATATGCTCTTTAGACCATCTAACTGGGTGTCGGAGGTGATGCAACTGACTTTC
ATGTCTGATGGTTTCAAGTCCTGGCTACTTGCGCTAGCATTCGGAATCTTCGTTTTGTCCTGGACAGCAGAGAAG
ACCATATTCCCTCGCGTGGCACAGATACTTGGACATACTCGTGCCCGCTTGCAGCAAAACTACCGCAAGAAGCGC
AAGATGTACAAAGTGCTGTTGGAGGGACTGCGCCTATGA
Gene >Pro_DTO377G3_2|g1587.t1
ATGCCCCGTCCGCACTCTCCCTCGGGGACTGGTCCTGTGGACCTATCTATGCCTCGAAACAGAATGCGACGCGAT
TCCATGCGAAGCAGGTTGCTATGCTCCCTTCCTACCCAAATCAACCCTTCAATCCCTGCTGATACTTCTCTAGTG
TGAGCGCCGTGTCGGATGTGGAGATGGCCCGTAATGAGGTATGTCAAATCTCCATTCTCACGTGCAGACTTCAGC
GCAGGATCTGACTCGCACTAGGTCTTCGATGGCCCGATCTCGGAAAGCATCCCTTCAAGCGTCGCCTCGTTCGCG
CACCGCCGTAACCGAGCAGGCTCTACGGTGAGCTTTACATACTTCCAGGACGGGGAAGACTTCGCAGAATTGTCG
AACGAATCTGCAGTGGACGAGCAAAGCGAGCTTGATGAAGAATCTTTACACGGCATTGGGGATGCAGATGTTGAG
TCAGTCAGGGGATCCTTTGTGTCTAAGCGGATGTCTACCTCCCGCGACTCGGTTGAACATCCACTTCTTTCTCGC
TACCTGTCCGCCAGCTCATATGGCCGAGACCGACGATCCGGCAGTCGGTTGAATCAAAAAGTCTATCTCGCCTCG
GAAGATTTGACGGCTGTCTTTGCTGGGTTCTCCACGAGTTCAGGAGGGTTTGCTGTCTATATTGCCCTTTGCATC
TTGACCGGTGGATTTGCCTGGCTTCTCTTCCGATGGCTGCCACGATGGCGGGTAAAGTTAGTTGGGAAGGCAACC
CCATTAGGAAAATGCCAATGGGTGGCTATTGAGGTAAGATTGTGAACTTCAATCCCATACATTAACCATCTGACC
ATGGTATCATGGTAGGACCAATGGAACCAATTCACCATCCACAAAGTTGGCAGCCAGCCTTATGGACGTCCGCTT
TCCACGGTCTTCGCCGACTCACTGAATCACACCTACGATGAAGATAATGACCCGACTATTACCTCTCTGCACTTC
ATCGACTATCGATATCTGAAGTTCTTCTATCATCCAATCGAGGATAAATTTTGCTTGATAAGCGGCTGGAAAGAT
CCTTCGTGGACTAATGCCAAAGTCATGCGAAGTGGATTAGATGCCGATGAACGAGACAGCAGGGAACAGATATTC
GGAAGTAACGACATCGAAATTGATGCAAAGACAATTCCTCAGCTTCTCGTCGACGAGGTCAGTTTTCCTTCTAGT
TGTTCCATCAATATATCTGACAGTGTATAGGCATTTCATCCTTTTTATATCTTCCAGATTGCAAGTCTCGTTCTG
TGGTCCATGGATGAGTACTACTACTACGCCGTCTGTATCTTTCTTATATCGTTTTTCAGCATAGCAACGACTGTG
CTAGAGACGAAATCAGTGCGTTCAGCCCAAGAATGGGACCATTATCTGAAACTAACGCTACTATAGACTATGAGT
CGGCTCAGGGAGATATCTCTTTTCGAGTGTGATGTTCGCGTTCTAAGAAGTGGATTCTGTGAGTTTGTTCGATGC
ATCATCTCACCGAATGTAAACTGATTGTATATATAGGGCGGTCCGTTTCCTCCCAAGAACTAGTTCCTGGTGATG
TTTATGAATTTTCCGACCCATCGCTTCACCAGGTCCCGTGTGACTGTATCTTGTTGTCAGGTGACTGCATTGTGA
ATGAGAGCATGCTCACTGGTTCGTAAAAACCCTCAGTATTGATGCATACATCTAACTTGACCAGGTGAATCCGTC
CCTGTGTCTAAAACACCACTCACCGATGACGCCATCCAATATCTCGATCTCAGTACCCCTTCTATCCACCCCCAT
GTTGCTAAACACTTCCTCTTCAGCGGAACCAAAGTAATCCGGGCTAGACGACCCCAGAATGTTGATGACGATGAA
GCAGTAGCATTGGCAATTGTCATGAGAACTGGCTTTTCGACAACCAAGGGGGCTCTAGTTCGATCGATGCTTTTT
CCGAAACCCTCTGGATTCAAGTTCTACCGAGACTCGTTCCGCTACATCGCCGTGATGGGGATTGTCGCTCTCATC
GGATTCGTTGCTTCATTCATTAACTTTGTTCGATTGGGTGTAAGTTAATGCTCGGAACGACGATTTTCCTAAGGT
TATGTTGGCCGCTGATGCAACGAAATATAGCTCGCTTGGCATCTGATCATAATTCGAGCCCTCGATCTGATCACG
ATTGTTGTACCGCCAGCTCTCCCAGCCACACTCACCATCGGAACCAATTTTGCACTTTCACGACTGAAGAAACAG
AACATATTCTGTATCAGCCCACAGAAGTGAGTGACCTCCGATGAATAATGTCTTAACTTCGACGCTAATACGTGA
GAACAGGGTCAACGTGGGAGGAAAGCTGGACATTGTTTGTTTTGATAAAACAGGAACCCTCACAGAAGACGGACT
GGATGTCCTAGGAATGCGTATAGTCACCCGTGCCAATAGGTTTGTCTGTTCCTAAGTATGACCCTTAAGCCGGCG
CTGAAGATGAATCTCTAGATTTTCAGACTTGCTCTCTGAGACGAATGACGGGTTTCTTCGTCCTTCCCCCGATGC
TAACTCCGAATACGATATCAAAAAGCAAAGGAAGATCATGTACGCCATGGCTACGTGTCATTCCCTTAGGGTAGT
GGACAATGAGCTGTTGGGAGATCCTCTCGATGTCAAGATGTTTCAATTTACCAACTGGACGTTTGAGGAGGGAGG
GGATCATATTTCTGACCAGACAAGCCCCAAATATGACACTATAGCGCCGTCAGTTGCAAAGCCTCCTCAAGGACA
GACTAATGGTGATGTAAATGTGAGTTGATTTATATTCAGGCCACAACTTGATGGCTAACAATATTCAGAACCCAC
TCGAGCTTGGAGTTCTGCGGAGTTTCGAATTTGTCTCCAATCTTCGCCGCGCAAGTGTCGTTGTCAGGAAATTTG
GCGACAACGGAGCAAGTTTCTTTGTCAAGGGTGCTCCAGAAAGCATTATGGACATATGTATTCCTGGAACTCGTC
AGTGCTTTCTACGCTCTCTATATAAGCTTGCATTGCTGATATACTTCTTTTGCAGTTCCTTCGGATTATGAAGAT
CTCCTGAATTACTACACTCACAAGGGATACCGTGTGATTGCCTGTGCTTCCAAATATGAACCAAAATTGAGCTGG
AGAAAAGTCCAAAAAATGTCTCGGACGGAAGCCGAATCTGACCTGGAATTCTTGGGTTTCATCATATTCGAGAAT
AAGTTGAAGCCCAGTACTGCCGGTGTGATTTCCGAGTTGAACGAGGCGGGGATTCGCAATGTAATGTGCACCGGT
GATAACATCTTGACTGCCATCAGTGTTGCTCGTGAATGCAACATGCTTGGACGTGATGAGCTATGCTTTATCCCG
CACTTTATCGAATGTTTGTTTACCGAATCCATGCCATAGCTCAGTATTAACGATCTCCAGCGCCTGGTCTTGCAC
CTAAAGCTTCTCTCATATGGGAATGCGTGGACAACTCCGACCTCCGCTTGGACCCAAGAACACTCTTGGTAAGAT
ATATTTTCCCTATATCCAATTATTAGCAGCTAATGGAATTGCAGCCACTCAACGACGCGGAGGTCGACATGTCAA
TTCCAGGAAACGTTTTCACCGAGCGTGAATACTCTGTTGCTGTCACGGGTGATGCCTTTAGATGGTTGGTTGACT
TCGGGAATGAAGATGTACTCAACAAGGTAAGCAGCCGTTGTACTAACCATTACCATTTTTTACCATGCGTCGAAC
TAATGTGTACTGTATAGGTACTTGTATGCGGCAAAGTGTTTGCCCGTATGTCCCCGGACGAGAAGCACGAACTAG
TTGAGAAACTTCAGTCTATTGATTACTGCTGTGGCTTTTGCGGCGATGGTGCCAATGATTGTGGCGCTCTGAAGG
CCGCAGATGTTGGTATTTCACTGTCGGACGCCGAGGCGTCCGTTGCCGCACCCTTTACTAGCCGCGTGTTCGAAA
TCTCTTGTGTTCCGACGGTGATCAGGGAAGGTCGAGCTGCGCTGGTGACAAGTTTCTCCTGTTTCAAGTTCATGA
GTCTTTATTCCGCCATTCAATTCTCCTCGGTCAGCTTCCTGTACACGTCGGGGTCAAATCTTGGTGATTTCCAGG
TAAGTGGGCTTATTACCAACAGTTTTGATATATCGCTAATGGCCTCAAGTTCCTCTTTATCGATCTTCTGCTCAT
TATGCCCATTGCGGTCTTCAGTGAGTGGTCTCTCTCCTAAAATCTGAGTCCTCGAGCTAATTTCATTCTAGTGGG
CTGGGCTGATCCTGCTCCCACGATGTCTCGGAAACGGCCAACTGCTGATCTTGTTTCCCGTAAGGTATTGACACC
TTTGCTCGGGCAGATCTTGCTAGTTGTGCTGTCGCAATTTGCAGTTTTCCAGACCGTTCAATTACAGCCATGGTC
AGTAACCGTTACAATATACCCATTAAAATTATTCTAACAAACAATGCAGGTTCTTGCCGCCACAATTGGACAAAG
AAAAGAGCAACATTCTCAATTCAGAGAATACTTCTTTGTTCTTGTTTTCCTGTTTCCAGTACATCTTCATCAGCA
TTGTTCTGAGTGCGGGTCCGCCATTCCGGAAACCAATGACTCAGAATGGTAAGAAGCACACCACTAACTTCCCCT
TCTTGCTCATCTAGATACTGACTATGATCGTTTAGTGCCGTACTTATGTACGATCATCGTCAACATCTTGGTCTC
GGGCTATATGCTCTTTAGACCATCTAACTGGGTGTCGGAGGTGATGCAACTGACTTTCATGTCTGATGGTTTCAA
GTCCTGGCTACTTGCGCTAGCATTCGGAATCTTCGTTTTGTCCTGGACAGCAGAGAAGACCATATTCCCTCGCGT
GGCACAGATACTTGGACATACTCGTGCCCGCTTGCAGCAAAACTACCGCAAGAAGCGCAAGATGTACAAAGTGCT
GTTGGAGGGACTGCGCCTATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail