Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g158.t1
Gene name
Locationscaffold_01:401171..414313
Strand-
Gene length (bp)13142
Transcript length (bp)13029
Coding sequence length (bp)13029
Protein length (aa) 4343

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08385 DHC_N1 Dynein heavy chain, N-terminal region 1 4.5E-124 267 846
PF12774 AAA_6 Hydrolytic ATP binding site of dynein motor region 3.3E-122 1897 2238
PF08393 DHC_N2 Dynein heavy chain, N-terminal region 2 1.5E-113 1356 1754
PF12781 AAA_9 ATP-binding dynein motor region 4.7E-75 3562 3781
PF12780 AAA_8 P-loop containing dynein motor region D4 7.4E-65 2908 3186
PF12777 MT Microtubule-binding stalk of dynein motor 2.9E-41 3201 3531
PF12775 AAA_7 P-loop containing dynein motor region 3.1E-36 2562 2737
PF07728 AAA_5 AAA domain (dynein-related subfamily) 5.5E-10 2226 2360
PF07728 AAA_5 AAA domain (dynein-related subfamily) 1.3E-04 2590 2727
PF07728 AAA_5 AAA domain (dynein-related subfamily) 9.0E-06 2932 3088
PF18198 AAA_lid_11 Dynein heavy chain AAA lid domain 7.7E-30 4137 4309
PF03028 Dynein_heavy Dynein heavy chain region D6 P-loop domain 8.9E-25 4020 4136
PF17852 Dynein_AAA_lid Dynein heavy chain AAA lid domain 7.2E-16 2431 2549
PF00004 AAA ATPase family associated with various cellular activities (AAA) 1.0E-04 2591 2716

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0030286 dynein complex Yes
GO:0003777 microtubule motor activity Yes
GO:0016887 ATPase activity Yes
GO:0007018 microtubule-based movement Yes
GO:0097367 carbohydrate derivative binding No
GO:0005875 microtubule associated complex No
GO:0017076 purine nucleotide binding No
GO:1901265 nucleoside phosphate binding No
GO:0017111 nucleoside-triphosphatase activity No
GO:0009987 cellular process No
GO:0043168 anion binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0003824 catalytic activity No
GO:0032553 ribonucleotide binding No
GO:0044446 intracellular organelle part No
GO:0016462 pyrophosphatase activity No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:0097159 organic cyclic compound binding No
GO:0032555 purine ribonucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0006928 movement of cell or subcellular component No
GO:0044464 cell part No
GO:0003674 molecular_function No
GO:0036094 small molecule binding No
GO:1902494 catalytic complex No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0005488 binding No
GO:0044424 intracellular part No
GO:0003774 motor activity No
GO:0044422 organelle part No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0043167 ion binding No
GO:0030554 adenyl nucleotide binding No
GO:0000166 nucleotide binding No
GO:0008144 drug binding No
GO:0008150 biological_process No
GO:0044430 cytoskeletal part No
GO:0016787 hydrolase activity No
GO:0032991 protein-containing complex No
GO:0005575 cellular_component No
GO:0007017 microtubule-based process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 40 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g158.t1
MEVASSGVPNGASAPETAALVDSGAVIQYLTEVLQVTLGAQRFELESAGSLLSESKYNETLQRCTRFASESQVAL
YVQKDIVTVEETDSETEDQDTAVKYAYNLSSDISSAPTTVSSVAIIKRPVPIDMSLPIASQVQVMNLPGPATLSN
TTAQQGNSMSPYQILHLMIHHGLSPYFESYTRSQETAIGTKSKTDTEAKTGIPGTKKRFADLELGLMHLQQNVEI
PALNLPLHEMVQAALKEAETRGIKPSVELIPSAVLESSAFTNSIQNVVNGWIRSIQTITKMSRDPDSESASPEVN
FWLSLEAALEGIEAQLQSDGVRLTMDILRHAKRYQPTLSFVADTGLKEATELVQKYNQLMRDFPLDELLSATSLQ
KVQESLNLIFTHLNKKLKICPYPIKRALSLVEAISGDLDKKIHELINGRTILHLDYREFRSLMKTTQAIWRTWDE
NLKEFTNVARESTRRRNEKFIPIKINARHDKTRERLKYVDTFRINHEQLQKTIINVLGPNSSSSAENGAGVDADG
AVIVEEIGDVDAVEEVAHAYAALKNVDVLDVSPEGSLTWEQAEIAYSERTSRVENSIIARLRDRLATARNANEMF
RVFSKFNALLVRPKIRGAIGEYQTQLIDNVKRDISALHERFKQQYGNSEAHAMAQLRDLPPVSGAIIWTRQIEHQ
LDGYMRKVENVLGENWHLHAEGQKLQNEGNLFRKKLDTRPVFESWLWDVQRRHFTIAGRLFNVVRNRSAGNVWEL
AVNFDAQIIALFKEVRNLIWLNFQVPHAVSNISKEAKRVYPYAISLMESVRTLLQTNRAIASMTDVNMLLNGYMN
DAQIMVAKGIPLRWESFVHSYELHVKQSALANGMEASLPGRSESKHVQFVREFAVSASTLQTKTSVLDAINENIQ
KSIHELKTCPYDSSAFKQRLDSIQVAVDKLNLENYVNLGYWVAELNGSIEAILRDRLIRAVREWIMTFQGINNEN
STSHHQLATAEADALNYKIQFPELFHEILMRNQVLHLDPPLQFARASWFSHFDAWLGVICNLEKIKPSRYQISIV
VQNVRLSEVCFSDLPQNCTDQLNEVYNVVESRLKDVSEYVDKWLQFQSLWDLRSEQVYEILGDDLSQWLQLLQEI
RKSRATFDTSEVSRGFGNIRIDYEQVQTKVNAKYDQWQHEILVKFGSKLGGRMREVHSEIAAARRDLEGQTLEAS
STAHAVSFITIVQQCKRKTRVWEPEVDLFRQGQTTLARQRYQFPYDWLHVENVDGEWAALNELLSRKSKIVNEQT
EALRAKISAEDHVIAGKIAEVIGKWNDEKPVSGTIPPEEASRTLSSFQSRLEALQSEFEMVSKAKEALDLPPSSE
SSLPPILEEVQDFMSVWAALATIWNSLNDLRDGLWTSVQPRKLRQSLDNLIKMTKEMPSRMRQYAAFEHIQNVLR
QLLKVNSLLSDMKSEAVKERHWHKIYKSLKPDKRFSLVSLTLGDVWDLQLASSDSIIRAIIAQAQGEMALEEFLK
SVRETWQNYSLDLVHYQNKCRLIKGFDDLFAKCSENLNSLQAMRHSPYYKEFEEEATSWEDKLNRVHVLFDVWID
VQRQWVYLEGVFTGNADIKHLLPLESGRFQNINSEFFTVMKKVYKSPFVLDILAIVDVQKSLERLADLLNKIQKA
LGEYLERERVSFPRFYFVGDEDLLEIIGNSNDIFRVAKHFKKMFAGMSGLVMDDDNNIVAFTSKEGEEVRLKKEV
NLLKTPRINDWLSALENSMKLTLAELLGEAVEQFGVLYHSSDVDRTAFNDFLSNYPAQIVVLASQVTWTNAVQHS
LEEGGATLPALHGSEVRILELLAATVLGELDPITRKKCEHMITEFVHQRDCISKLISLNATTPTHYHWLLQMRYV
FHDSGDFLERLYVHMANAKLAYGFEYLGVPERLVRTPLTDRCFLTLTQALCQRLGGSPYGPAGTGKTESVKALGL
QLGRFTLVFCCDDTFDFQAMGRIFLGICQVGAWGCFDEFNRLEERILSAVSQQIQNIQIGLKTGGDGDKAQIELV
GRRLAVNSNTGIFITMNPGYAGRSNLPDNLKKLFRSVAMSKPDKELIAEVMLFSQGFKQAKSLSKQTVPFFDHCA
SRLSKQAHYDFGLRALKSVLVSSGGLKRARLASTEGDLGPEDVIEPQIIVQSLRETIAPKLIREDVEIMLEIQVE
DFAGVDYVPANFEKLTQAIRDIATKEQHLVDSEMWITKALQLYQIQCIHHGVMMVGKSGAGKSTAWKILLQAMQR
IEGVEGVSHIIDSKVMSKESLYGNLDSTTREWTDGLFTGILRKIVDNLRGEDSKRHWIVFDGDVDPEWVENLNSV
LDDNKLLTLPNGERLNLPSNVRIMFEVESLKYATLATVSRCGMVWFNADTVTPTMMISNYVESLRTKTFEDLDED
SAPAGTAVIRTQDAQDTVATILKQFLEVDDLVLRALVEAKKYNHIMEFTDIRALNTLFSLLNKACRNVLEYNVQH
PDFPLDSEQIESYMSKKLLLTLVWSLTGDCPLSDRKEFGKYITGMSTIDLPPDGDSSLIDYDVLLPKSDWTSWHS
QVPTIDINTHSVTQTDVIIPTVDTIRHEDVLYSWLAEHKPLLLCGPPGSGKTMTLFAALRKLPNMEVVGLNFSSA
TTPDLLIKTFEQYCEYKKTLNGVVMSPNQIGRWLVIFCDEINLPAPDRYGTQRAISFLRQLVEQNGFWRTTDKTW
VTLDRIQFVGACNPPTDAGRTPMAERFLRHAPLIMVDYPGEISLNQIYGTFNSAVLKILPLLRGYSEALTRAMVQ
FYLESQTRFTPQIQPHYVYSPRELTRWVRGLYEAIKPLETLSVEGLVRIWAHEALRLFQDRLVDEDERAWTADAV
RRIALEHFPSIDEQEALKGPILFSNWLSKNYVPVEQESLREFVKARLRTFCEEEVDVPLVLFNDVLEHALRIDRV
FRQPQGHLILIGVSGSGKTTLSRFVAWMNGLKVFQIKVHGKYSSEDFDDDLRSVLRRAGCKGEKICFVMDESNVL
DSGFLERMNTLLANAEVPGLFEGDEFSSLMTACKEGAQRQGLLLDSQEELYKWFTSQIVKNLHVVFTMNPPEEGL
SSKAATSPALFNRCVLNWMGDWSDQALFQVGSELTQSVDLDKPNFISPDSIPVAYRELTLPASHRDTVVNSMVFI
HHSLHRFNGRLHKQQGRTTFLTPRHYLDFVAQYVKLFNEKREDLEEQQRHLNIGLEKLHDTVDKVSDLRASLAQK
KTQLEKKDTEANDKLQRMVADQQEAEQRKHVSLEVQAALEIQEKEVATRKEVVLNDLARAEPAVLEAQKSVSNIK
RQHLTEVRSMGNPPASVRLALEAVCTLLGHTVDSWKTIQGLIRRDDFIASIVNYDNERQMTRRHRTKMQNEFLSK
EDFTYERVNRASKACGPLVQWVEAQVNYSAILDRVGPLREEVDQLEEQALQTKAEAQAIENTINDLETSIATYKA
EYAALISETQAIKTEMNRVQFKVDRSVRLLDSLSSERGRWEEGSKSFETQISTLVGDVLIAAAFLAYAGLYDQQF
RKAMAEDWVHQLAASGIQFKPHNPITEYLSNADERLTWQSHSLPVDDLCTENAIILKRFNRYPLIVDPSGRITEF
LQKESKDRKLTVTSFLDDSFVKQLESALRFGNPILIQDAEHLDPILNHVLNKEYQKTGGRVLIQLGKQEIDFSPS
FKLFLSTRDPSATFPPDICSRTTFVNFTVTQSSLQTQSLNDVLKFERPDVDERRNNLVKMQGEFKVHLRQLEKRL
LQALNESRGNILDDDNVIETLETLKKEAAEISLKMDQTEGVMLEVDNVTQNYSIIARSCSAVFAVLEQLHHINHF
YQFSLQYFVDIFNSVLYQNKRLAQEKDHAARVQIIVRDLFINTYKRTSLGLVQKDRITLAILLAQATPFPMDRTI
LDRVLDETVEDADLSTSVDTRDQVMTRLANMSLFKEHIPNVTQEQWDRFFGEELAENVVPVMWDESVSQLDQLLR
SLLLVKICRMDRFVPSAERFVEAVFGRELFEGGADLKDVVDQVTATRPIALSSSPGFDASYKVDALVEATRATCA
NIAMGSNEGLESADKAISNAAAVGNWVLVKNVHLAPAWLQSLEKRLDSLKPHKEFRLFLSMESSPKIPVNLIRAS
RVLMYEQPAGVRANMKDSLSSLSVRASKPPVEKARVYLLLCFLHAVVQERLRYAPSLGWKGFWEFNDSDYECSAH
IIDYWVDSVSQGRSNVAPQKIPWEMIRTLVAEMYGGKIDDAGDYQQLENLVNSFLTPAAFEDGYKLVSGVENDNL
LTLPETTSMREFVVWVNNLPEREPPTYLGLPANAEKLLLVGHGRKMISDLSRVTTLLDEGEQLMVDA*
Coding >Pro_DTO377G3_2|g158.t1
ATGGAGGTCGCCTCATCAGGTGTGCCAAATGGCGCCTCAGCACCAGAGACCGCAGCTCTGGTTGATTCCGGCGCG
GTCATTCAGTACTTGACCGAAGTGCTTCAGGTGACACTGGGAGCCCAAAGGTTCGAGCTGGAAAGCGCTGGGAGC
TTGCTTTCGGAATCAAAGTACAATGAAACACTACAACGGTGTACACGATTTGCCTCAGAATCGCAAGTTGCACTC
TATGTGCAAAAGGACATTGTGACAGTGGAGGAAACCGACAGTGAAACGGAGGACCAAGATACAGCGGTGAAATAT
GCCTACAATCTCTCCTCCGATATCTCGTCCGCTCCTACAACCGTATCCTCCGTGGCGATCATAAAACGGCCTGTT
CCAATCGACATGAGTCTTCCGATAGCGTCGCAAGTCCAAGTCATGAATCTCCCCGGCCCCGCTACTCTCAGCAAT
ACCACCGCCCAGCAGGGGAATTCCATGTCACCCTACCAAATCCTACATTTGATGATACACCATGGTCTGAGTCCT
TACTTCGAATCCTACACTCGCAGCCAGGAGACAGCTATCGGCACGAAATCGAAAACGGATACGGAAGCGAAGACT
GGTATCCCAGGAACAAAGAAGAGATTCGCAGATTTGGAGCTAGGGTTGATGCACCTCCAGCAGAATGTAGAAATT
CCAGCTCTGAACCTGCCTCTTCATGAAATGGTGCAGGCTGCTCTTAAGGAAGCGGAAACACGTGGTATCAAACCA
TCGGTCGAGTTGATTCCATCGGCGGTATTGGAGAGCAGCGCTTTCACAAACAGCATTCAGAATGTCGTGAACGGT
TGGATTAGATCCATTCAGACAATCACTAAGATGTCCCGTGATCCCGACAGCGAATCTGCTTCTCCTGAGGTCAAC
TTCTGGCTGTCCTTAGAGGCTGCCTTGGAGGGAATCGAAGCTCAGCTCCAAAGCGATGGTGTTCGGTTGACTATG
GACATTCTTCGCCATGCGAAACGATACCAACCAACCCTCAGTTTCGTGGCAGACACTGGGCTGAAAGAGGCCACT
GAATTGGTCCAGAAGTACAACCAGCTGATGCGAGACTTTCCTCTCGATGAACTCCTGTCTGCGACCTCTTTGCAG
AAGGTCCAGGAATCACTAAACTTGATTTTCACTCACCTGAATAAAAAGCTAAAGATTTGCCCCTACCCCATTAAG
CGGGCACTTTCGCTCGTTGAAGCAATCTCGGGCGATCTTGATAAGAAGATCCATGAGCTGATCAATGGACGTACG
ATCTTGCATCTGGACTATCGCGAGTTCCGGTCTTTGATGAAGACCACACAAGCGATTTGGCGCACTTGGGATGAG
AACTTGAAGGAATTCACAAACGTTGCTCGCGAATCAACACGGCGTCGTAACGAAAAATTTATTCCTATTAAGATC
AATGCGAGACACGACAAAACCCGCGAGCGGCTGAAGTACGTCGACACATTCAGGATCAACCATGAACAGCTCCAG
AAAACCATTATCAACGTTCTAGGTCCCAACAGCTCTTCATCTGCCGAGAATGGAGCTGGAGTTGATGCTGACGGC
GCTGTGATAGTCGAGGAGATTGGTGATGTTGATGCCGTAGAGGAAGTTGCGCACGCCTACGCTGCTCTCAAGAAC
GTGGACGTTTTGGATGTCTCACCGGAGGGATCTCTCACCTGGGAACAGGCTGAAATTGCCTACAGTGAGCGTACT
TCCCGTGTTGAGAACTCTATCATTGCTCGCCTTCGTGACCGTCTGGCGACCGCCAGGAATGCCAATGAGATGTTC
CGTGTGTTCTCGAAGTTCAACGCCCTTCTCGTTCGTCCTAAGATTCGTGGTGCAATTGGCGAATATCAAACGCAA
CTTATTGACAATGTCAAGCGAGACATCAGTGCTTTGCATGAGCGCTTCAAACAACAGTACGGTAATTCGGAAGCT
CATGCTATGGCCCAACTGCGGGACCTGCCCCCCGTGTCGGGCGCCATTATTTGGACTCGCCAGATCGAGCATCAG
CTTGATGGCTACATGCGAAAGGTCGAGAATGTTCTCGGTGAGAACTGGCACCTACACGCAGAGGGCCAGAAATTA
CAGAATGAGGGTAACCTGTTCCGTAAGAAGCTCGATACCCGGCCTGTTTTCGAGTCATGGCTGTGGGATGTTCAA
CGGCGTCATTTTACAATTGCTGGACGGTTGTTTAATGTTGTGCGCAACCGATCTGCAGGAAACGTTTGGGAGCTG
GCAGTCAACTTCGATGCTCAGATAATTGCCCTCTTCAAGGAGGTCCGCAATCTTATCTGGCTCAACTTCCAAGTT
CCTCATGCTGTCAGCAATATCTCGAAGGAGGCTAAGCGTGTTTACCCCTACGCCATTAGCCTGATGGAGAGTGTT
CGCACCCTGTTGCAGACCAATCGAGCAATCGCGTCGATGACCGATGTCAATATGCTGCTCAACGGCTACATGAAC
GATGCACAGATTATGGTTGCCAAGGGTATCCCTCTCCGGTGGGAATCCTTCGTCCATTCTTACGAGCTACACGTC
AAGCAGTCAGCATTGGCAAATGGCATGGAGGCATCGTTGCCTGGTCGGTCTGAAAGCAAGCATGTTCAATTTGTC
CGTGAGTTTGCCGTTTCAGCATCGACACTTCAGACGAAAACTAGCGTTCTTGACGCCATCAATGAGAACATTCAG
AAATCGATCCATGAACTCAAGACATGCCCATACGACTCATCAGCTTTCAAGCAACGCTTGGACAGCATCCAAGTT
GCTGTTGATAAGCTTAACCTCGAAAATTACGTGAACCTTGGATACTGGGTTGCTGAGCTTAATGGAAGCATCGAG
GCAATTCTGCGCGACCGACTTATTCGCGCTGTGCGCGAGTGGATTATGACCTTCCAAGGTATCAACAACGAAAAC
TCGACTTCTCATCATCAACTTGCGACGGCCGAAGCGGATGCTTTGAATTACAAGATCCAGTTCCCGGAACTCTTC
CACGAGATTCTGATGAGAAACCAAGTCCTCCATCTGGACCCGCCGTTACAATTTGCACGCGCAAGCTGGTTCTCC
CACTTTGATGCATGGCTCGGTGTGATTTGCAATCTGGAAAAGATCAAGCCCTCGCGTTATCAGATCTCCATTGTC
GTGCAAAATGTTCGCCTGTCCGAAGTCTGCTTCTCCGACCTCCCGCAAAATTGCACCGATCAGCTCAATGAAGTC
TACAATGTTGTCGAGTCCAGACTGAAGGATGTTTCTGAGTATGTCGATAAGTGGCTGCAGTTCCAATCACTTTGG
GATCTTCGGTCTGAGCAGGTTTACGAAATCCTGGGAGATGATCTGTCTCAATGGCTTCAGCTTCTTCAGGAAATT
AGAAAGAGTCGGGCTACATTCGATACTTCTGAAGTCAGCCGCGGCTTCGGAAATATCAGGATTGATTACGAGCAA
GTCCAAACCAAGGTGAATGCCAAATACGACCAGTGGCAGCATGAGATCCTCGTGAAGTTTGGTTCTAAGCTTGGC
GGCCGCATGAGAGAGGTTCATTCCGAGATTGCTGCTGCCCGAAGGGACTTGGAAGGCCAAACCCTAGAGGCCTCT
TCAACGGCGCATGCCGTGTCTTTCATTACCATTGTTCAGCAGTGCAAGCGGAAGACTCGAGTCTGGGAGCCCGAG
GTTGACCTCTTCCGTCAAGGCCAAACCACACTCGCCCGCCAACGTTACCAGTTCCCGTATGACTGGCTTCACGTT
GAGAATGTTGATGGTGAATGGGCAGCCCTTAACGAGCTGCTTAGCCGCAAGAGCAAAATTGTCAACGAGCAAACC
GAAGCCTTGCGTGCAAAGATTAGCGCTGAAGACCACGTCATTGCCGGCAAGATTGCCGAAGTTATCGGTAAATGG
AATGATGAGAAGCCGGTCTCTGGCACTATTCCACCCGAGGAAGCATCTCGCACCCTGAGCTCTTTCCAGTCTCGC
CTCGAGGCTCTCCAGTCTGAGTTTGAGATGGTCTCAAAGGCCAAGGAAGCTCTCGATCTTCCCCCAAGTTCCGAG
TCATCACTTCCCCCCATCCTCGAGGAGGTCCAAGACTTCATGTCTGTCTGGGCTGCTCTAGCAACAATCTGGAAC
AGTCTTAATGACCTTCGCGATGGGCTGTGGACCAGCGTGCAACCTAGGAAGCTCCGACAGTCTCTTGACAACTTG
ATCAAAATGACCAAGGAGATGCCCAGTCGCATGAGACAGTATGCTGCCTTTGAACACATTCAGAATGTTCTTCGG
CAGCTGCTGAAAGTCAACTCACTTTTGTCAGACATGAAATCCGAAGCCGTCAAGGAAAGACATTGGCACAAAATA
TACAAGAGTCTTAAACCCGACAAGCGTTTCTCTCTTGTCTCTTTGACCCTTGGTGATGTCTGGGATTTACAACTC
GCATCAAGCGATTCCATCATTCGTGCTATCATTGCACAGGCACAGGGTGAGATGGCATTGGAGGAATTCCTGAAG
TCTGTTCGGGAGACATGGCAGAACTATTCTCTGGACCTAGTACACTACCAGAACAAATGCCGTCTGATAAAAGGC
TTTGACGACCTGTTCGCCAAGTGCAGCGAAAATCTGAACTCCCTCCAGGCCATGAGACATTCTCCGTACTACAAA
GAATTTGAAGAAGAAGCTACATCATGGGAAGATAAACTGAACCGAGTCCATGTCCTTTTCGACGTATGGATCGAC
GTCCAGCGACAATGGGTCTACCTGGAAGGCGTCTTTACCGGCAACGCAGACATCAAGCATCTTCTTCCTTTGGAG
TCGGGCCGTTTCCAGAATATCAACTCGGAATTCTTTACTGTCATGAAGAAGGTGTACAAATCTCCGTTCGTTTTG
GATATTCTCGCAATTGTAGATGTTCAAAAGTCCTTGGAGAGACTGGCTGATTTGCTGAACAAAATCCAAAAGGCA
CTCGGTGAATATTTGGAGCGTGAACGTGTCTCATTTCCTCGCTTTTACTTTGTTGGAGATGAGGACTTGTTGGAG
ATCATTGGTAACAGCAATGATATCTTCCGTGTCGCCAAGCATTTCAAGAAGATGTTCGCTGGGATGTCAGGCCTT
GTCATGGATGACGATAACAATATTGTTGCATTTACCTCCAAGGAGGGCGAAGAAGTCCGTTTGAAGAAAGAGGTT
AACCTCCTCAAGACTCCTCGTATTAATGATTGGCTCTCCGCGCTAGAGAACAGCATGAAGTTGACTCTAGCAGAA
CTTCTCGGCGAGGCCGTTGAACAATTTGGAGTTCTTTACCATAGCAGCGATGTGGACCGAACGGCTTTCAATGAC
TTCTTGTCTAACTACCCTGCTCAGATTGTGGTCCTCGCCAGTCAGGTCACTTGGACCAACGCAGTGCAACATTCC
TTGGAGGAAGGAGGTGCAACCCTCCCTGCGTTGCACGGTTCCGAAGTTCGGATTCTCGAGTTGCTGGCTGCGACG
GTGCTTGGTGAACTCGATCCGATCACTCGCAAGAAGTGTGAGCATATGATCACGGAATTCGTTCACCAGCGCGAC
TGCATCTCCAAGCTCATAAGTCTCAATGCCACAACGCCAACTCACTACCATTGGCTTCTCCAGATGCGTTATGTC
TTCCACGATTCGGGCGATTTCTTGGAGCGCCTATATGTCCACATGGCCAACGCGAAGCTCGCCTATGGATTCGAG
TATTTAGGTGTGCCTGAGCGTCTTGTCCGCACGCCTCTCACAGATCGTTGTTTCCTCACCCTTACTCAGGCTCTT
TGCCAGAGACTGGGTGGTTCGCCATATGGCCCTGCTGGTACCGGTAAAACCGAGTCAGTCAAGGCATTGGGCCTG
CAACTCGGTCGTTTCACCCTCGTCTTCTGTTGTGACGACACATTCGATTTCCAAGCAATGGGTCGAATTTTCCTC
GGTATCTGTCAGGTTGGAGCGTGGGGTTGCTTTGACGAGTTCAACCGTCTGGAAGAACGTATTTTGTCGGCCGTC
TCTCAGCAGATCCAGAACATCCAGATTGGTCTGAAAACTGGCGGAGATGGCGACAAGGCCCAAATTGAACTCGTA
GGAAGACGACTCGCTGTGAACTCCAACACCGGAATTTTCATTACCATGAACCCTGGCTACGCTGGTCGTTCCAAT
TTGCCAGACAACTTGAAGAAGCTGTTCCGCAGTGTTGCCATGTCCAAACCGGATAAGGAACTGATTGCTGAAGTG
ATGCTTTTCTCGCAAGGTTTCAAGCAGGCCAAGTCTCTCTCCAAGCAGACAGTCCCCTTCTTCGACCACTGTGCT
TCCCGACTTTCCAAGCAGGCTCATTACGACTTCGGTCTCCGTGCATTGAAGAGTGTTCTTGTTAGCTCAGGCGGT
CTCAAGCGCGCGCGTCTGGCCAGTACCGAGGGAGATCTAGGCCCCGAGGATGTCATTGAACCTCAAATCATTGTT
CAAAGTCTCCGGGAGACAATTGCTCCTAAGCTTATTCGAGAAGATGTGGAAATCATGCTGGAAATCCAGGTGGAA
GACTTCGCTGGCGTGGATTATGTGCCTGCCAACTTCGAGAAACTCACCCAAGCGATCCGTGATATTGCTACCAAA
GAGCAACATCTCGTCGACAGTGAGATGTGGATCACCAAGGCACTGCAACTCTATCAAATTCAATGCATCCACCAT
GGTGTTATGATGGTTGGTAAGTCAGGAGCCGGTAAATCAACTGCCTGGAAGATTTTACTGCAAGCGATGCAGCGC
ATTGAGGGCGTTGAGGGCGTCTCTCACATCATCGACTCTAAGGTCATGTCTAAGGAATCTCTCTATGGTAACCTT
GACAGCACTACCCGTGAATGGACAGACGGTCTCTTCACTGGAATTCTGAGAAAGATCGTAGACAACCTCCGAGGC
GAGGATAGCAAACGCCATTGGATTGTTTTCGACGGAGATGTTGACCCTGAATGGGTTGAGAACCTGAACAGTGTT
CTAGATGACAACAAACTCCTCACCCTTCCCAATGGAGAGCGTCTCAACCTACCTTCAAATGTTCGCATCATGTTT
GAAGTTGAAAGCTTGAAGTATGCCACGCTTGCCACAGTCAGTCGTTGCGGTATGGTGTGGTTCAATGCCGACACT
GTTACTCCAACCATGATGATTTCCAACTACGTCGAAAGCCTCAGGACAAAGACATTCGAGGACCTGGATGAAGAC
AGTGCTCCCGCAGGGACAGCAGTAATCCGGACACAGGATGCCCAGGACACAGTTGCAACAATCCTCAAACAGTTC
TTGGAGGTTGATGACCTGGTTCTCAGAGCTTTGGTGGAAGCAAAGAAATACAACCATATCATGGAGTTCACGGAT
ATCCGCGCCCTCAACACTCTCTTCAGCTTGTTGAACAAGGCCTGCCGAAACGTCCTCGAATACAATGTCCAGCAT
CCAGACTTCCCTCTGGACTCTGAACAGATTGAGTCCTACATGTCCAAGAAGCTTCTTCTGACGCTGGTCTGGTCT
CTTACCGGTGATTGTCCACTAAGTGATCGCAAGGAGTTCGGAAAATACATCACTGGAATGTCTACTATCGATCTT
CCACCGGACGGCGATTCATCTTTGATTGACTATGACGTTCTTCTTCCCAAGTCTGACTGGACTAGTTGGCATTCA
CAGGTGCCCACGATTGATATCAACACACATTCCGTCACTCAAACCGATGTCATTATCCCCACGGTCGATACTATC
CGTCATGAAGATGTGTTGTACTCGTGGCTTGCTGAGCATAAGCCTTTGTTGCTCTGCGGTCCTCCTGGATCCGGT
AAGACCATGACATTGTTCGCCGCGCTCCGAAAGCTCCCGAACATGGAGGTCGTTGGTCTCAACTTCTCGAGTGCC
ACCACACCTGACCTCCTGATCAAGACCTTTGAGCAGTACTGTGAGTACAAGAAGACTCTTAATGGTGTGGTGATG
TCTCCGAACCAGATCGGCCGCTGGCTTGTCATTTTCTGCGACGAGATCAATCTTCCGGCCCCTGATCGCTACGGC
ACTCAGCGTGCCATCTCATTCCTGCGCCAACTTGTGGAGCAGAATGGCTTCTGGCGAACCACCGACAAGACCTGG
GTCACCCTGGATCGCATTCAATTTGTTGGTGCCTGTAATCCTCCTACGGATGCTGGTCGTACACCGATGGCTGAG
AGATTCCTGCGTCATGCTCCCCTGATCATGGTCGACTACCCCGGCGAGATCTCTCTCAACCAAATCTATGGCACG
TTCAACTCTGCTGTGCTTAAGATCCTTCCGTTGCTGCGTGGATACTCCGAGGCCCTCACCAGGGCCATGGTTCAG
TTCTACCTCGAATCCCAAACCCGCTTCACGCCCCAAATCCAGCCCCACTACGTTTACTCGCCTCGTGAGCTCACT
AGATGGGTTCGGGGTCTGTATGAGGCCATCAAGCCATTGGAAACCCTTTCTGTTGAAGGCCTGGTCCGCATTTGG
GCGCACGAAGCCCTGCGTCTATTCCAGGACAGACTCGTGGATGAAGATGAGAGAGCTTGGACGGCAGATGCTGTT
CGCCGCATTGCCTTGGAACATTTCCCTTCAATCGATGAACAAGAAGCATTGAAGGGTCCTATCCTGTTCTCCAAC
TGGCTGTCCAAGAACTACGTGCCTGTCGAACAGGAGAGTCTGCGTGAATTCGTGAAGGCACGTCTAAGAACCTTC
TGCGAAGAAGAGGTGGATGTTCCGCTTGTGTTGTTCAACGATGTCCTTGAGCACGCGCTACGCATCGATCGAGTC
TTCCGCCAGCCTCAAGGTCATCTCATTCTTATCGGTGTGAGTGGAAGTGGAAAGACAACTCTGTCTCGCTTCGTC
GCTTGGATGAATGGTTTGAAGGTCTTCCAGATCAAGGTACACGGGAAGTACTCTTCGGAAGATTTCGATGACGAT
CTTCGCAGCGTTCTTCGCCGGGCAGGATGCAAAGGCGAAAAGATTTGCTTTGTCATGGATGAATCAAACGTTCTT
GACTCTGGATTCCTGGAACGCATGAATACTTTGCTTGCAAACGCAGAAGTCCCTGGTCTCTTTGAGGGCGACGAA
TTCTCCTCATTGATGACTGCTTGTAAAGAGGGTGCCCAGCGTCAAGGCTTGCTCCTAGATTCGCAGGAGGAGCTG
TACAAGTGGTTCACCTCGCAAATCGTTAAGAACCTGCACGTTGTCTTTACCATGAACCCGCCAGAGGAGGGTCTA
TCTTCAAAAGCAGCTACTAGTCCCGCCTTGTTCAATCGTTGTGTCCTGAACTGGATGGGTGACTGGTCTGACCAA
GCCTTGTTCCAAGTTGGCTCCGAGCTCACTCAATCGGTCGATCTAGACAAACCAAACTTCATCTCGCCTGATAGC
ATCCCAGTAGCATACCGCGAGTTGACTCTCCCAGCATCACACAGAGACACTGTTGTCAATTCCATGGTGTTTATT
CACCACTCCTTGCATCGCTTCAATGGGCGGCTCCACAAACAACAGGGCCGGACGACTTTCCTCACCCCTCGCCAT
TATCTCGACTTTGTTGCGCAGTATGTCAAGCTTTTCAACGAGAAGCGCGAGGATCTCGAGGAGCAACAACGTCAC
TTGAACATTGGTCTCGAAAAGCTTCATGACACCGTCGACAAAGTGAGCGACCTTCGAGCTAGTCTCGCACAGAAG
AAGACACAATTGGAGAAGAAGGATACGGAAGCGAACGATAAATTGCAGCGTATGGTCGCTGATCAGCAAGAAGCA
GAACAGCGGAAGCACGTTTCATTGGAAGTGCAGGCCGCGTTAGAGATACAAGAGAAGGAAGTGGCAACTCGGAAA
GAAGTCGTGTTGAACGATTTGGCCCGGGCTGAACCCGCTGTCCTGGAAGCCCAGAAGAGTGTCAGCAACATTAAA
CGTCAACACCTCACGGAAGTTCGGTCCATGGGTAACCCTCCGGCTAGCGTCCGACTTGCCCTGGAAGCCGTATGC
ACACTCCTCGGACACACCGTCGATAGTTGGAAAACAATCCAAGGTCTCATTCGTCGGGATGATTTCATCGCCAGC
ATCGTTAACTACGACAATGAGCGCCAGATGACGCGCAGACACCGTACTAAGATGCAGAATGAATTCCTGTCGAAG
GAAGACTTCACCTATGAGCGAGTTAACCGTGCCAGTAAGGCCTGCGGTCCTTTAGTGCAATGGGTTGAAGCCCAG
GTCAACTACTCTGCGATCCTTGATCGTGTTGGCCCTCTACGTGAAGAGGTGGATCAACTTGAGGAGCAGGCCCTG
CAAACCAAGGCCGAAGCTCAGGCCATCGAAAATACCATCAATGACCTCGAAACTAGCATCGCCACCTACAAGGCC
GAGTACGCTGCCCTTATCAGCGAGACGCAGGCAATCAAGACCGAGATGAATCGGGTTCAATTCAAGGTCGACCGC
AGTGTTCGTTTGCTTGATAGTTTGTCCTCTGAGCGTGGGCGCTGGGAAGAAGGGAGCAAGTCATTCGAAACTCAG
ATCAGCACTCTCGTTGGCGATGTTCTCATTGCAGCTGCATTCCTTGCATATGCTGGTCTTTACGATCAGCAATTC
CGTAAGGCAATGGCTGAGGACTGGGTCCACCAACTGGCGGCATCTGGCATTCAATTCAAGCCTCACAATCCCATA
ACGGAATACTTGTCTAATGCCGATGAACGCTTGACCTGGCAGAGTCATTCTCTTCCCGTTGACGATCTTTGCACA
GAGAACGCCATCATTCTCAAGAGATTCAACAGATACCCGCTTATTGTTGATCCCTCTGGCCGTATTACAGAATTT
TTACAGAAGGAAAGCAAAGATCGCAAACTCACTGTCACGAGCTTCTTGGACGATTCCTTTGTCAAGCAATTGGAG
AGCGCGTTGCGTTTCGGAAACCCCATCCTTATCCAGGATGCCGAGCATCTGGACCCGATTCTCAATCACGTTCTC
AACAAGGAATACCAGAAAACTGGTGGTCGTGTCCTCATTCAATTGGGCAAGCAAGAAATCGATTTCTCGCCATCC
TTCAAGCTCTTCCTATCCACCCGGGATCCATCTGCCACATTCCCGCCGGATATTTGCAGTCGAACTACCTTCGTC
AACTTCACTGTCACCCAGAGCAGCTTGCAAACACAGTCTTTGAATGATGTCCTGAAATTCGAGCGGCCCGATGTC
GATGAACGTCGCAACAACCTTGTCAAGATGCAAGGAGAGTTCAAGGTCCACCTTAGACAACTCGAGAAGCGTCTT
TTGCAGGCGCTCAACGAGTCCCGTGGTAACATTCTCGATGATGACAATGTCATTGAAACTCTTGAAACTCTCAAA
AAGGAGGCTGCCGAGATTTCTCTGAAGATGGATCAAACCGAAGGTGTTATGCTCGAGGTGGACAACGTTACGCAG
AACTACAGCATCATTGCCCGTTCCTGCAGTGCCGTCTTTGCGGTTCTAGAACAACTTCACCACATCAATCACTTC
TACCAGTTCTCTCTGCAGTATTTCGTCGATATTTTCAATTCTGTTCTCTACCAGAACAAACGCCTTGCTCAGGAG
AAGGATCATGCTGCGCGTGTCCAGATTATTGTTAGGGACTTGTTCATCAACACCTATAAGCGAACCTCCCTTGGT
CTCGTTCAAAAGGATCGCATCACACTTGCCATTCTGCTTGCTCAAGCTACCCCATTCCCCATGGACAGGACCATT
CTCGACCGCGTCCTGGATGAGACAGTGGAGGACGCGGATCTTTCAACTTCTGTGGACACTCGCGACCAAGTGATG
ACGAGGCTGGCCAACATGTCCCTCTTCAAAGAGCATATTCCAAACGTCACCCAAGAACAGTGGGATCGTTTCTTC
GGCGAGGAGCTTGCAGAGAACGTGGTCCCGGTTATGTGGGACGAGAGTGTGTCGCAACTGGATCAACTGCTTCGG
TCCTTGCTCCTTGTCAAGATTTGCCGCATGGACCGATTTGTTCCCAGTGCCGAGCGTTTCGTCGAGGCGGTGTTC
GGCCGCGAGCTGTTCGAGGGTGGTGCCGACCTAAAGGATGTAGTTGACCAGGTCACTGCAACCAGGCCCATCGCG
CTCAGCTCCAGCCCTGGCTTCGATGCCAGTTACAAGGTCGACGCTCTTGTTGAAGCCACCCGCGCAACCTGCGCC
AACATTGCCATGGGATCTAACGAAGGTCTCGAAAGCGCGGACAAGGCCATCAGCAACGCAGCTGCAGTCGGTAAC
TGGGTGCTGGTCAAGAACGTCCACCTGGCGCCTGCTTGGCTGCAAAGTCTCGAGAAGAGACTGGATTCTCTCAAA
CCACACAAGGAATTCCGTCTTTTCCTATCTATGGAGTCCAGCCCTAAGATCCCTGTCAATTTGATCCGGGCCTCG
CGTGTGCTGATGTACGAACAGCCCGCGGGTGTGCGTGCCAACATGAAGGATTCCCTCTCTTCGCTGAGTGTGAGA
GCCAGCAAGCCTCCAGTCGAAAAGGCCCGTGTCTATCTCTTACTCTGCTTCTTGCACGCCGTCGTCCAGGAAAGG
CTCCGCTATGCACCAAGCCTTGGATGGAAGGGCTTCTGGGAGTTCAACGACAGCGACTACGAGTGCTCAGCCCAC
ATCATTGACTACTGGGTCGATTCAGTGTCCCAAGGCCGTTCCAACGTGGCTCCGCAGAAGATTCCCTGGGAGATG
ATCCGCACTCTTGTCGCAGAGATGTACGGTGGTAAAATCGACGACGCAGGCGATTACCAGCAGCTCGAGAACCTG
GTCAATAGCTTCCTTACACCCGCCGCCTTCGAAGATGGCTACAAGCTCGTCTCGGGTGTAGAGAACGACAATCTT
TTGACGCTGCCGGAGACCACTAGCATGCGCGAGTTCGTCGTCTGGGTTAACAATCTGCCGGAGCGTGAACCCCCT
ACCTACCTGGGTCTCCCTGCCAATGCCGAGAAGCTCTTGTTGGTCGGCCATGGCCGTAAGATGATTTCTGATCTC
TCGCGGGTTACGACTCTTCTTGATGAAGGAGAGCAGTTGATGGTCGATGCCTGA
Transcript >Pro_DTO377G3_2|g158.t1
ATGGAGGTCGCCTCATCAGGTGTGCCAAATGGCGCCTCAGCACCAGAGACCGCAGCTCTGGTTGATTCCGGCGCG
GTCATTCAGTACTTGACCGAAGTGCTTCAGGTGACACTGGGAGCCCAAAGGTTCGAGCTGGAAAGCGCTGGGAGC
TTGCTTTCGGAATCAAAGTACAATGAAACACTACAACGGTGTACACGATTTGCCTCAGAATCGCAAGTTGCACTC
TATGTGCAAAAGGACATTGTGACAGTGGAGGAAACCGACAGTGAAACGGAGGACCAAGATACAGCGGTGAAATAT
GCCTACAATCTCTCCTCCGATATCTCGTCCGCTCCTACAACCGTATCCTCCGTGGCGATCATAAAACGGCCTGTT
CCAATCGACATGAGTCTTCCGATAGCGTCGCAAGTCCAAGTCATGAATCTCCCCGGCCCCGCTACTCTCAGCAAT
ACCACCGCCCAGCAGGGGAATTCCATGTCACCCTACCAAATCCTACATTTGATGATACACCATGGTCTGAGTCCT
TACTTCGAATCCTACACTCGCAGCCAGGAGACAGCTATCGGCACGAAATCGAAAACGGATACGGAAGCGAAGACT
GGTATCCCAGGAACAAAGAAGAGATTCGCAGATTTGGAGCTAGGGTTGATGCACCTCCAGCAGAATGTAGAAATT
CCAGCTCTGAACCTGCCTCTTCATGAAATGGTGCAGGCTGCTCTTAAGGAAGCGGAAACACGTGGTATCAAACCA
TCGGTCGAGTTGATTCCATCGGCGGTATTGGAGAGCAGCGCTTTCACAAACAGCATTCAGAATGTCGTGAACGGT
TGGATTAGATCCATTCAGACAATCACTAAGATGTCCCGTGATCCCGACAGCGAATCTGCTTCTCCTGAGGTCAAC
TTCTGGCTGTCCTTAGAGGCTGCCTTGGAGGGAATCGAAGCTCAGCTCCAAAGCGATGGTGTTCGGTTGACTATG
GACATTCTTCGCCATGCGAAACGATACCAACCAACCCTCAGTTTCGTGGCAGACACTGGGCTGAAAGAGGCCACT
GAATTGGTCCAGAAGTACAACCAGCTGATGCGAGACTTTCCTCTCGATGAACTCCTGTCTGCGACCTCTTTGCAG
AAGGTCCAGGAATCACTAAACTTGATTTTCACTCACCTGAATAAAAAGCTAAAGATTTGCCCCTACCCCATTAAG
CGGGCACTTTCGCTCGTTGAAGCAATCTCGGGCGATCTTGATAAGAAGATCCATGAGCTGATCAATGGACGTACG
ATCTTGCATCTGGACTATCGCGAGTTCCGGTCTTTGATGAAGACCACACAAGCGATTTGGCGCACTTGGGATGAG
AACTTGAAGGAATTCACAAACGTTGCTCGCGAATCAACACGGCGTCGTAACGAAAAATTTATTCCTATTAAGATC
AATGCGAGACACGACAAAACCCGCGAGCGGCTGAAGTACGTCGACACATTCAGGATCAACCATGAACAGCTCCAG
AAAACCATTATCAACGTTCTAGGTCCCAACAGCTCTTCATCTGCCGAGAATGGAGCTGGAGTTGATGCTGACGGC
GCTGTGATAGTCGAGGAGATTGGTGATGTTGATGCCGTAGAGGAAGTTGCGCACGCCTACGCTGCTCTCAAGAAC
GTGGACGTTTTGGATGTCTCACCGGAGGGATCTCTCACCTGGGAACAGGCTGAAATTGCCTACAGTGAGCGTACT
TCCCGTGTTGAGAACTCTATCATTGCTCGCCTTCGTGACCGTCTGGCGACCGCCAGGAATGCCAATGAGATGTTC
CGTGTGTTCTCGAAGTTCAACGCCCTTCTCGTTCGTCCTAAGATTCGTGGTGCAATTGGCGAATATCAAACGCAA
CTTATTGACAATGTCAAGCGAGACATCAGTGCTTTGCATGAGCGCTTCAAACAACAGTACGGTAATTCGGAAGCT
CATGCTATGGCCCAACTGCGGGACCTGCCCCCCGTGTCGGGCGCCATTATTTGGACTCGCCAGATCGAGCATCAG
CTTGATGGCTACATGCGAAAGGTCGAGAATGTTCTCGGTGAGAACTGGCACCTACACGCAGAGGGCCAGAAATTA
CAGAATGAGGGTAACCTGTTCCGTAAGAAGCTCGATACCCGGCCTGTTTTCGAGTCATGGCTGTGGGATGTTCAA
CGGCGTCATTTTACAATTGCTGGACGGTTGTTTAATGTTGTGCGCAACCGATCTGCAGGAAACGTTTGGGAGCTG
GCAGTCAACTTCGATGCTCAGATAATTGCCCTCTTCAAGGAGGTCCGCAATCTTATCTGGCTCAACTTCCAAGTT
CCTCATGCTGTCAGCAATATCTCGAAGGAGGCTAAGCGTGTTTACCCCTACGCCATTAGCCTGATGGAGAGTGTT
CGCACCCTGTTGCAGACCAATCGAGCAATCGCGTCGATGACCGATGTCAATATGCTGCTCAACGGCTACATGAAC
GATGCACAGATTATGGTTGCCAAGGGTATCCCTCTCCGGTGGGAATCCTTCGTCCATTCTTACGAGCTACACGTC
AAGCAGTCAGCATTGGCAAATGGCATGGAGGCATCGTTGCCTGGTCGGTCTGAAAGCAAGCATGTTCAATTTGTC
CGTGAGTTTGCCGTTTCAGCATCGACACTTCAGACGAAAACTAGCGTTCTTGACGCCATCAATGAGAACATTCAG
AAATCGATCCATGAACTCAAGACATGCCCATACGACTCATCAGCTTTCAAGCAACGCTTGGACAGCATCCAAGTT
GCTGTTGATAAGCTTAACCTCGAAAATTACGTGAACCTTGGATACTGGGTTGCTGAGCTTAATGGAAGCATCGAG
GCAATTCTGCGCGACCGACTTATTCGCGCTGTGCGCGAGTGGATTATGACCTTCCAAGGTATCAACAACGAAAAC
TCGACTTCTCATCATCAACTTGCGACGGCCGAAGCGGATGCTTTGAATTACAAGATCCAGTTCCCGGAACTCTTC
CACGAGATTCTGATGAGAAACCAAGTCCTCCATCTGGACCCGCCGTTACAATTTGCACGCGCAAGCTGGTTCTCC
CACTTTGATGCATGGCTCGGTGTGATTTGCAATCTGGAAAAGATCAAGCCCTCGCGTTATCAGATCTCCATTGTC
GTGCAAAATGTTCGCCTGTCCGAAGTCTGCTTCTCCGACCTCCCGCAAAATTGCACCGATCAGCTCAATGAAGTC
TACAATGTTGTCGAGTCCAGACTGAAGGATGTTTCTGAGTATGTCGATAAGTGGCTGCAGTTCCAATCACTTTGG
GATCTTCGGTCTGAGCAGGTTTACGAAATCCTGGGAGATGATCTGTCTCAATGGCTTCAGCTTCTTCAGGAAATT
AGAAAGAGTCGGGCTACATTCGATACTTCTGAAGTCAGCCGCGGCTTCGGAAATATCAGGATTGATTACGAGCAA
GTCCAAACCAAGGTGAATGCCAAATACGACCAGTGGCAGCATGAGATCCTCGTGAAGTTTGGTTCTAAGCTTGGC
GGCCGCATGAGAGAGGTTCATTCCGAGATTGCTGCTGCCCGAAGGGACTTGGAAGGCCAAACCCTAGAGGCCTCT
TCAACGGCGCATGCCGTGTCTTTCATTACCATTGTTCAGCAGTGCAAGCGGAAGACTCGAGTCTGGGAGCCCGAG
GTTGACCTCTTCCGTCAAGGCCAAACCACACTCGCCCGCCAACGTTACCAGTTCCCGTATGACTGGCTTCACGTT
GAGAATGTTGATGGTGAATGGGCAGCCCTTAACGAGCTGCTTAGCCGCAAGAGCAAAATTGTCAACGAGCAAACC
GAAGCCTTGCGTGCAAAGATTAGCGCTGAAGACCACGTCATTGCCGGCAAGATTGCCGAAGTTATCGGTAAATGG
AATGATGAGAAGCCGGTCTCTGGCACTATTCCACCCGAGGAAGCATCTCGCACCCTGAGCTCTTTCCAGTCTCGC
CTCGAGGCTCTCCAGTCTGAGTTTGAGATGGTCTCAAAGGCCAAGGAAGCTCTCGATCTTCCCCCAAGTTCCGAG
TCATCACTTCCCCCCATCCTCGAGGAGGTCCAAGACTTCATGTCTGTCTGGGCTGCTCTAGCAACAATCTGGAAC
AGTCTTAATGACCTTCGCGATGGGCTGTGGACCAGCGTGCAACCTAGGAAGCTCCGACAGTCTCTTGACAACTTG
ATCAAAATGACCAAGGAGATGCCCAGTCGCATGAGACAGTATGCTGCCTTTGAACACATTCAGAATGTTCTTCGG
CAGCTGCTGAAAGTCAACTCACTTTTGTCAGACATGAAATCCGAAGCCGTCAAGGAAAGACATTGGCACAAAATA
TACAAGAGTCTTAAACCCGACAAGCGTTTCTCTCTTGTCTCTTTGACCCTTGGTGATGTCTGGGATTTACAACTC
GCATCAAGCGATTCCATCATTCGTGCTATCATTGCACAGGCACAGGGTGAGATGGCATTGGAGGAATTCCTGAAG
TCTGTTCGGGAGACATGGCAGAACTATTCTCTGGACCTAGTACACTACCAGAACAAATGCCGTCTGATAAAAGGC
TTTGACGACCTGTTCGCCAAGTGCAGCGAAAATCTGAACTCCCTCCAGGCCATGAGACATTCTCCGTACTACAAA
GAATTTGAAGAAGAAGCTACATCATGGGAAGATAAACTGAACCGAGTCCATGTCCTTTTCGACGTATGGATCGAC
GTCCAGCGACAATGGGTCTACCTGGAAGGCGTCTTTACCGGCAACGCAGACATCAAGCATCTTCTTCCTTTGGAG
TCGGGCCGTTTCCAGAATATCAACTCGGAATTCTTTACTGTCATGAAGAAGGTGTACAAATCTCCGTTCGTTTTG
GATATTCTCGCAATTGTAGATGTTCAAAAGTCCTTGGAGAGACTGGCTGATTTGCTGAACAAAATCCAAAAGGCA
CTCGGTGAATATTTGGAGCGTGAACGTGTCTCATTTCCTCGCTTTTACTTTGTTGGAGATGAGGACTTGTTGGAG
ATCATTGGTAACAGCAATGATATCTTCCGTGTCGCCAAGCATTTCAAGAAGATGTTCGCTGGGATGTCAGGCCTT
GTCATGGATGACGATAACAATATTGTTGCATTTACCTCCAAGGAGGGCGAAGAAGTCCGTTTGAAGAAAGAGGTT
AACCTCCTCAAGACTCCTCGTATTAATGATTGGCTCTCCGCGCTAGAGAACAGCATGAAGTTGACTCTAGCAGAA
CTTCTCGGCGAGGCCGTTGAACAATTTGGAGTTCTTTACCATAGCAGCGATGTGGACCGAACGGCTTTCAATGAC
TTCTTGTCTAACTACCCTGCTCAGATTGTGGTCCTCGCCAGTCAGGTCACTTGGACCAACGCAGTGCAACATTCC
TTGGAGGAAGGAGGTGCAACCCTCCCTGCGTTGCACGGTTCCGAAGTTCGGATTCTCGAGTTGCTGGCTGCGACG
GTGCTTGGTGAACTCGATCCGATCACTCGCAAGAAGTGTGAGCATATGATCACGGAATTCGTTCACCAGCGCGAC
TGCATCTCCAAGCTCATAAGTCTCAATGCCACAACGCCAACTCACTACCATTGGCTTCTCCAGATGCGTTATGTC
TTCCACGATTCGGGCGATTTCTTGGAGCGCCTATATGTCCACATGGCCAACGCGAAGCTCGCCTATGGATTCGAG
TATTTAGGTGTGCCTGAGCGTCTTGTCCGCACGCCTCTCACAGATCGTTGTTTCCTCACCCTTACTCAGGCTCTT
TGCCAGAGACTGGGTGGTTCGCCATATGGCCCTGCTGGTACCGGTAAAACCGAGTCAGTCAAGGCATTGGGCCTG
CAACTCGGTCGTTTCACCCTCGTCTTCTGTTGTGACGACACATTCGATTTCCAAGCAATGGGTCGAATTTTCCTC
GGTATCTGTCAGGTTGGAGCGTGGGGTTGCTTTGACGAGTTCAACCGTCTGGAAGAACGTATTTTGTCGGCCGTC
TCTCAGCAGATCCAGAACATCCAGATTGGTCTGAAAACTGGCGGAGATGGCGACAAGGCCCAAATTGAACTCGTA
GGAAGACGACTCGCTGTGAACTCCAACACCGGAATTTTCATTACCATGAACCCTGGCTACGCTGGTCGTTCCAAT
TTGCCAGACAACTTGAAGAAGCTGTTCCGCAGTGTTGCCATGTCCAAACCGGATAAGGAACTGATTGCTGAAGTG
ATGCTTTTCTCGCAAGGTTTCAAGCAGGCCAAGTCTCTCTCCAAGCAGACAGTCCCCTTCTTCGACCACTGTGCT
TCCCGACTTTCCAAGCAGGCTCATTACGACTTCGGTCTCCGTGCATTGAAGAGTGTTCTTGTTAGCTCAGGCGGT
CTCAAGCGCGCGCGTCTGGCCAGTACCGAGGGAGATCTAGGCCCCGAGGATGTCATTGAACCTCAAATCATTGTT
CAAAGTCTCCGGGAGACAATTGCTCCTAAGCTTATTCGAGAAGATGTGGAAATCATGCTGGAAATCCAGGTGGAA
GACTTCGCTGGCGTGGATTATGTGCCTGCCAACTTCGAGAAACTCACCCAAGCGATCCGTGATATTGCTACCAAA
GAGCAACATCTCGTCGACAGTGAGATGTGGATCACCAAGGCACTGCAACTCTATCAAATTCAATGCATCCACCAT
GGTGTTATGATGGTTGGTAAGTCAGGAGCCGGTAAATCAACTGCCTGGAAGATTTTACTGCAAGCGATGCAGCGC
ATTGAGGGCGTTGAGGGCGTCTCTCACATCATCGACTCTAAGGTCATGTCTAAGGAATCTCTCTATGGTAACCTT
GACAGCACTACCCGTGAATGGACAGACGGTCTCTTCACTGGAATTCTGAGAAAGATCGTAGACAACCTCCGAGGC
GAGGATAGCAAACGCCATTGGATTGTTTTCGACGGAGATGTTGACCCTGAATGGGTTGAGAACCTGAACAGTGTT
CTAGATGACAACAAACTCCTCACCCTTCCCAATGGAGAGCGTCTCAACCTACCTTCAAATGTTCGCATCATGTTT
GAAGTTGAAAGCTTGAAGTATGCCACGCTTGCCACAGTCAGTCGTTGCGGTATGGTGTGGTTCAATGCCGACACT
GTTACTCCAACCATGATGATTTCCAACTACGTCGAAAGCCTCAGGACAAAGACATTCGAGGACCTGGATGAAGAC
AGTGCTCCCGCAGGGACAGCAGTAATCCGGACACAGGATGCCCAGGACACAGTTGCAACAATCCTCAAACAGTTC
TTGGAGGTTGATGACCTGGTTCTCAGAGCTTTGGTGGAAGCAAAGAAATACAACCATATCATGGAGTTCACGGAT
ATCCGCGCCCTCAACACTCTCTTCAGCTTGTTGAACAAGGCCTGCCGAAACGTCCTCGAATACAATGTCCAGCAT
CCAGACTTCCCTCTGGACTCTGAACAGATTGAGTCCTACATGTCCAAGAAGCTTCTTCTGACGCTGGTCTGGTCT
CTTACCGGTGATTGTCCACTAAGTGATCGCAAGGAGTTCGGAAAATACATCACTGGAATGTCTACTATCGATCTT
CCACCGGACGGCGATTCATCTTTGATTGACTATGACGTTCTTCTTCCCAAGTCTGACTGGACTAGTTGGCATTCA
CAGGTGCCCACGATTGATATCAACACACATTCCGTCACTCAAACCGATGTCATTATCCCCACGGTCGATACTATC
CGTCATGAAGATGTGTTGTACTCGTGGCTTGCTGAGCATAAGCCTTTGTTGCTCTGCGGTCCTCCTGGATCCGGT
AAGACCATGACATTGTTCGCCGCGCTCCGAAAGCTCCCGAACATGGAGGTCGTTGGTCTCAACTTCTCGAGTGCC
ACCACACCTGACCTCCTGATCAAGACCTTTGAGCAGTACTGTGAGTACAAGAAGACTCTTAATGGTGTGGTGATG
TCTCCGAACCAGATCGGCCGCTGGCTTGTCATTTTCTGCGACGAGATCAATCTTCCGGCCCCTGATCGCTACGGC
ACTCAGCGTGCCATCTCATTCCTGCGCCAACTTGTGGAGCAGAATGGCTTCTGGCGAACCACCGACAAGACCTGG
GTCACCCTGGATCGCATTCAATTTGTTGGTGCCTGTAATCCTCCTACGGATGCTGGTCGTACACCGATGGCTGAG
AGATTCCTGCGTCATGCTCCCCTGATCATGGTCGACTACCCCGGCGAGATCTCTCTCAACCAAATCTATGGCACG
TTCAACTCTGCTGTGCTTAAGATCCTTCCGTTGCTGCGTGGATACTCCGAGGCCCTCACCAGGGCCATGGTTCAG
TTCTACCTCGAATCCCAAACCCGCTTCACGCCCCAAATCCAGCCCCACTACGTTTACTCGCCTCGTGAGCTCACT
AGATGGGTTCGGGGTCTGTATGAGGCCATCAAGCCATTGGAAACCCTTTCTGTTGAAGGCCTGGTCCGCATTTGG
GCGCACGAAGCCCTGCGTCTATTCCAGGACAGACTCGTGGATGAAGATGAGAGAGCTTGGACGGCAGATGCTGTT
CGCCGCATTGCCTTGGAACATTTCCCTTCAATCGATGAACAAGAAGCATTGAAGGGTCCTATCCTGTTCTCCAAC
TGGCTGTCCAAGAACTACGTGCCTGTCGAACAGGAGAGTCTGCGTGAATTCGTGAAGGCACGTCTAAGAACCTTC
TGCGAAGAAGAGGTGGATGTTCCGCTTGTGTTGTTCAACGATGTCCTTGAGCACGCGCTACGCATCGATCGAGTC
TTCCGCCAGCCTCAAGGTCATCTCATTCTTATCGGTGTGAGTGGAAGTGGAAAGACAACTCTGTCTCGCTTCGTC
GCTTGGATGAATGGTTTGAAGGTCTTCCAGATCAAGGTACACGGGAAGTACTCTTCGGAAGATTTCGATGACGAT
CTTCGCAGCGTTCTTCGCCGGGCAGGATGCAAAGGCGAAAAGATTTGCTTTGTCATGGATGAATCAAACGTTCTT
GACTCTGGATTCCTGGAACGCATGAATACTTTGCTTGCAAACGCAGAAGTCCCTGGTCTCTTTGAGGGCGACGAA
TTCTCCTCATTGATGACTGCTTGTAAAGAGGGTGCCCAGCGTCAAGGCTTGCTCCTAGATTCGCAGGAGGAGCTG
TACAAGTGGTTCACCTCGCAAATCGTTAAGAACCTGCACGTTGTCTTTACCATGAACCCGCCAGAGGAGGGTCTA
TCTTCAAAAGCAGCTACTAGTCCCGCCTTGTTCAATCGTTGTGTCCTGAACTGGATGGGTGACTGGTCTGACCAA
GCCTTGTTCCAAGTTGGCTCCGAGCTCACTCAATCGGTCGATCTAGACAAACCAAACTTCATCTCGCCTGATAGC
ATCCCAGTAGCATACCGCGAGTTGACTCTCCCAGCATCACACAGAGACACTGTTGTCAATTCCATGGTGTTTATT
CACCACTCCTTGCATCGCTTCAATGGGCGGCTCCACAAACAACAGGGCCGGACGACTTTCCTCACCCCTCGCCAT
TATCTCGACTTTGTTGCGCAGTATGTCAAGCTTTTCAACGAGAAGCGCGAGGATCTCGAGGAGCAACAACGTCAC
TTGAACATTGGTCTCGAAAAGCTTCATGACACCGTCGACAAAGTGAGCGACCTTCGAGCTAGTCTCGCACAGAAG
AAGACACAATTGGAGAAGAAGGATACGGAAGCGAACGATAAATTGCAGCGTATGGTCGCTGATCAGCAAGAAGCA
GAACAGCGGAAGCACGTTTCATTGGAAGTGCAGGCCGCGTTAGAGATACAAGAGAAGGAAGTGGCAACTCGGAAA
GAAGTCGTGTTGAACGATTTGGCCCGGGCTGAACCCGCTGTCCTGGAAGCCCAGAAGAGTGTCAGCAACATTAAA
CGTCAACACCTCACGGAAGTTCGGTCCATGGGTAACCCTCCGGCTAGCGTCCGACTTGCCCTGGAAGCCGTATGC
ACACTCCTCGGACACACCGTCGATAGTTGGAAAACAATCCAAGGTCTCATTCGTCGGGATGATTTCATCGCCAGC
ATCGTTAACTACGACAATGAGCGCCAGATGACGCGCAGACACCGTACTAAGATGCAGAATGAATTCCTGTCGAAG
GAAGACTTCACCTATGAGCGAGTTAACCGTGCCAGTAAGGCCTGCGGTCCTTTAGTGCAATGGGTTGAAGCCCAG
GTCAACTACTCTGCGATCCTTGATCGTGTTGGCCCTCTACGTGAAGAGGTGGATCAACTTGAGGAGCAGGCCCTG
CAAACCAAGGCCGAAGCTCAGGCCATCGAAAATACCATCAATGACCTCGAAACTAGCATCGCCACCTACAAGGCC
GAGTACGCTGCCCTTATCAGCGAGACGCAGGCAATCAAGACCGAGATGAATCGGGTTCAATTCAAGGTCGACCGC
AGTGTTCGTTTGCTTGATAGTTTGTCCTCTGAGCGTGGGCGCTGGGAAGAAGGGAGCAAGTCATTCGAAACTCAG
ATCAGCACTCTCGTTGGCGATGTTCTCATTGCAGCTGCATTCCTTGCATATGCTGGTCTTTACGATCAGCAATTC
CGTAAGGCAATGGCTGAGGACTGGGTCCACCAACTGGCGGCATCTGGCATTCAATTCAAGCCTCACAATCCCATA
ACGGAATACTTGTCTAATGCCGATGAACGCTTGACCTGGCAGAGTCATTCTCTTCCCGTTGACGATCTTTGCACA
GAGAACGCCATCATTCTCAAGAGATTCAACAGATACCCGCTTATTGTTGATCCCTCTGGCCGTATTACAGAATTT
TTACAGAAGGAAAGCAAAGATCGCAAACTCACTGTCACGAGCTTCTTGGACGATTCCTTTGTCAAGCAATTGGAG
AGCGCGTTGCGTTTCGGAAACCCCATCCTTATCCAGGATGCCGAGCATCTGGACCCGATTCTCAATCACGTTCTC
AACAAGGAATACCAGAAAACTGGTGGTCGTGTCCTCATTCAATTGGGCAAGCAAGAAATCGATTTCTCGCCATCC
TTCAAGCTCTTCCTATCCACCCGGGATCCATCTGCCACATTCCCGCCGGATATTTGCAGTCGAACTACCTTCGTC
AACTTCACTGTCACCCAGAGCAGCTTGCAAACACAGTCTTTGAATGATGTCCTGAAATTCGAGCGGCCCGATGTC
GATGAACGTCGCAACAACCTTGTCAAGATGCAAGGAGAGTTCAAGGTCCACCTTAGACAACTCGAGAAGCGTCTT
TTGCAGGCGCTCAACGAGTCCCGTGGTAACATTCTCGATGATGACAATGTCATTGAAACTCTTGAAACTCTCAAA
AAGGAGGCTGCCGAGATTTCTCTGAAGATGGATCAAACCGAAGGTGTTATGCTCGAGGTGGACAACGTTACGCAG
AACTACAGCATCATTGCCCGTTCCTGCAGTGCCGTCTTTGCGGTTCTAGAACAACTTCACCACATCAATCACTTC
TACCAGTTCTCTCTGCAGTATTTCGTCGATATTTTCAATTCTGTTCTCTACCAGAACAAACGCCTTGCTCAGGAG
AAGGATCATGCTGCGCGTGTCCAGATTATTGTTAGGGACTTGTTCATCAACACCTATAAGCGAACCTCCCTTGGT
CTCGTTCAAAAGGATCGCATCACACTTGCCATTCTGCTTGCTCAAGCTACCCCATTCCCCATGGACAGGACCATT
CTCGACCGCGTCCTGGATGAGACAGTGGAGGACGCGGATCTTTCAACTTCTGTGGACACTCGCGACCAAGTGATG
ACGAGGCTGGCCAACATGTCCCTCTTCAAAGAGCATATTCCAAACGTCACCCAAGAACAGTGGGATCGTTTCTTC
GGCGAGGAGCTTGCAGAGAACGTGGTCCCGGTTATGTGGGACGAGAGTGTGTCGCAACTGGATCAACTGCTTCGG
TCCTTGCTCCTTGTCAAGATTTGCCGCATGGACCGATTTGTTCCCAGTGCCGAGCGTTTCGTCGAGGCGGTGTTC
GGCCGCGAGCTGTTCGAGGGTGGTGCCGACCTAAAGGATGTAGTTGACCAGGTCACTGCAACCAGGCCCATCGCG
CTCAGCTCCAGCCCTGGCTTCGATGCCAGTTACAAGGTCGACGCTCTTGTTGAAGCCACCCGCGCAACCTGCGCC
AACATTGCCATGGGATCTAACGAAGGTCTCGAAAGCGCGGACAAGGCCATCAGCAACGCAGCTGCAGTCGGTAAC
TGGGTGCTGGTCAAGAACGTCCACCTGGCGCCTGCTTGGCTGCAAAGTCTCGAGAAGAGACTGGATTCTCTCAAA
CCACACAAGGAATTCCGTCTTTTCCTATCTATGGAGTCCAGCCCTAAGATCCCTGTCAATTTGATCCGGGCCTCG
CGTGTGCTGATGTACGAACAGCCCGCGGGTGTGCGTGCCAACATGAAGGATTCCCTCTCTTCGCTGAGTGTGAGA
GCCAGCAAGCCTCCAGTCGAAAAGGCCCGTGTCTATCTCTTACTCTGCTTCTTGCACGCCGTCGTCCAGGAAAGG
CTCCGCTATGCACCAAGCCTTGGATGGAAGGGCTTCTGGGAGTTCAACGACAGCGACTACGAGTGCTCAGCCCAC
ATCATTGACTACTGGGTCGATTCAGTGTCCCAAGGCCGTTCCAACGTGGCTCCGCAGAAGATTCCCTGGGAGATG
ATCCGCACTCTTGTCGCAGAGATGTACGGTGGTAAAATCGACGACGCAGGCGATTACCAGCAGCTCGAGAACCTG
GTCAATAGCTTCCTTACACCCGCCGCCTTCGAAGATGGCTACAAGCTCGTCTCGGGTGTAGAGAACGACAATCTT
TTGACGCTGCCGGAGACCACTAGCATGCGCGAGTTCGTCGTCTGGGTTAACAATCTGCCGGAGCGTGAACCCCCT
ACCTACCTGGGTCTCCCTGCCAATGCCGAGAAGCTCTTGTTGGTCGGCCATGGCCGTAAGATGATTTCTGATCTC
TCGCGGGTTACGACTCTTCTTGATGAAGGAGAGCAGTTGATGGTCGATGCCTGA
Gene >Pro_DTO377G3_2|g158.t1
ATGGAGGTCGCCTCATCAGGTGTGCCAAATGGCGCCTCAGCACCAGAGACCGCAGCTCTGGTTGATTCCGGCGCG
GTCATTCAGTACTTGACCGAAGTGCTTCAGGTGACACTGGGAGCCCAAAGGTTCGAGCTGGAAAGCGCTGGGAGC
TTGCTTTCGGAATCAAAGTACAATGAAACACTACAACGGTGTACACGATTTGCCTCAGAATCGCAAGTTGCACTC
TATGTGCAAAAGGACATTGTGACAGTGGAGGAAACCGACAGTGAAACGGAGGACCAAGGTATGTCAAACCCAAGT
GCATAGGCATTCAAAAATATGCTGCTAATTATGCCGCGAAGATACAGCGGTGAAATATGCCTACAATCTCTCCTC
CGATATCTCGTCCGCTCCTACAACCGTATCCTCCGTGGCGATCATAAAACGGCCTGTTCCAATCGACATGAGTCT
TCCGATAGCGTCGCAAGTCCAAGTCATGAATCTCCCCGGCCCCGCTACTCTCAGCAATACCACCGCCCAGCAGGG
GAATTCCATGTCACCCTACCAAATCCTACATTTGATGATACACCATGGTCTGAGTCCTTACTTCGAATCCTACAC
TCGCAGCCAGGAGACAGCTATCGGCACGAAATCGAAAACGGATACGGAAGCGAAGACTGGTATCCCAGGAACAAA
GAAGAGATTCGCAGATTTGGAGCTAGGGTTGATGCACCTCCAGCAGAATGTAGAAATTCCAGCTCTGAACCTGCC
TCTTCATGAAATGGTGCAGGCTGCTCTTAAGGAAGCGGAAACACGTGGTATCAAACCATCGGTCGAGTTGATTCC
ATCGGCGGTATTGGAGAGCAGCGCTTTCACAAACAGCATTCAGAATGTCGTGAACGGTTGGATTAGATCCATTCA
GACAATCACTAAGATGTCCCGTGATCCCGACAGCGAATCTGCTTCTCCTGAGGTCAACTTCTGGCTGTCCTTAGA
GGCTGCCTTGGAGGGAATCGAAGCTCAGCTCCAAAGCGATGGTGTTCGGTTGACTATGGACATTCTTCGCCATGC
GAAACGATACCAACCAACCCTCAGTTTCGTGGCAGACACTGGGCTGAAAGAGGCCACTGAATTGGTCCAGAAGTA
CAACCAGCTGATGCGAGACTTTCCTCTCGATGAACTCCTGTCTGCGACCTCTTTGCAGAAGGTCCAGGAATCACT
AAACTTGATTTTCACTCACCTGAATAAAAAGCTAAAGATTTGCCCCTACCCCATTAAGCGGGCACTTTCGCTCGT
TGAAGCAATCTCGGGCGATCTTGATAAGAAGATCCATGAGCTGATCAATGGACGTACGATCTTGCATCTGGACTA
TCGCGAGTTCCGGTCTTTGATGAAGACCACACAAGCGATTTGGCGCACTTGGGATGAGAACTTGAAGGAATTCAC
AAACGTTGCTCGCGAATCAACACGGCGTCGTAACGAAAAATTTATTCCTATTAAGATCAATGCGAGACACGACAA
AACCCGCGAGCGGCTGAAGTACGTCGACACATTCAGGATCAACCATGAACAGCTCCAGAAAACCATTATCAACGT
TCTAGGTCCCAACAGCTCTTCATCTGCCGAGAATGGAGCTGGAGTTGATGCTGACGGCGCTGTGATAGTCGAGGA
GATTGGTGATGTTGATGCCGTAGAGGAAGTTGCGCACGCCTACGCTGCTCTCAAGAACGTGGACGTTTTGGATGT
CTCACCGGAGGGATCTCTCACCTGGGAACAGGCTGAAATTGCCTACAGTGAGCGTACTTCCCGTGTTGAGAACTC
TATCATTGCTCGCCTTCGTGACCGTCTGGCGACCGCCAGGAATGCCAATGAGATGTTCCGTGTGTTCTCGAAGTT
CAACGCCCTTCTCGTTCGTCCTAAGATTCGTGGTGCAATTGGCGAATATCAAACGCAACTTATTGACAATGTCAA
GCGAGACATCAGTGCTTTGCATGAGCGCTTCAAACAACAGTACGGTAATTCGGAAGCTCATGCTATGGCCCAACT
GCGGGACCTGCCCCCCGTGTCGGGCGCCATTATTTGGACTCGCCAGATCGAGCATCAGCTTGATGGCTACATGCG
AAAGGTCGAGAATGTTCTCGGTGAGAACTGGCACCTACACGCAGAGGGCCAGAAATTACAGAATGAGGGTAACCT
GTTCCGTAAGAAGCTCGATACCCGGCCTGTTTTCGAGTCATGGCTGTGGGATGTTCAACGGCGTCATTTTACAAT
TGCTGGACGGTTGTTTAATGTTGTGCGCAACCGATCTGCAGGAAACGTTTGGGAGCTGGCAGTCAACTTCGATGC
TCAGATAATTGCCCTCTTCAAGGAGGTCCGCAATCTTATCTGGCTCAACTTCCAAGTTCCTCATGCTGTCAGCAA
TATCTCGAAGGAGGCTAAGCGTGTTTACCCCTACGCCATTAGCCTGATGGAGAGTGTTCGCACCCTGTTGCAGAC
CAATCGAGCAATCGCGTCGATGACCGATGTCAATATGCTGCTCAACGGCTACATGAACGATGCACAGATTATGGT
TGCCAAGGGTATCCCTCTCCGGTGGGAATCCTTCGTCCATTCTTACGAGCTACACGTCAAGCAGTCAGCATTGGC
AAATGGCATGGAGGCATCGTTGCCTGGTCGGTCTGAAAGCAAGCATGTTCAATTTGTCCGTGAGTTTGCCGTTTC
AGCATCGACACTTCAGACGAAAACTAGCGTTCTTGACGCCATCAATGAGAACATTCAGAAATCGATCCATGAACT
CAAGACATGCCCATACGACTCATCAGCTTTCAAGCAACGCTTGGACAGCATCCAAGTTGCTGTTGATAAGCTTAA
CCTCGAAAATTACGTGAACCTTGGATACTGGGTTGCTGAGCTTAATGGAAGCATCGAGGCAATTCTGCGCGACCG
ACTTATTCGCGCTGTGCGCGAGTGGATTATGACCTTCCAAGGTATCAACAACGAAAACTCGACTTCTCATCATCA
ACTTGCGACGGCCGAAGCGGATGCTTTGAATTACAAGATCCAGTTCCCGGAACTCTTCCACGAGATTCTGATGAG
AAACCAAGTCCTCCATCTGGACCCGCCGTTACAATTTGCACGCGCAAGCTGGTTCTCCCACTTTGATGCATGGCT
CGGTGTGATTTGCAATCTGGAAAAGATCAAGCCCTCGCGTTATCAGATCTCCATTGTCGTGCAAAATGTTCGCCT
GTCCGAAGTCTGCTTCTCCGACCTCCCGCAAAATTGCACCGATCAGCTCAATGAAGTCTACAATGTTGTCGAGTC
CAGACTGAAGGATGTTTCTGAGTATGTCGATAAGTGGCTGCAGTTCCAATCACTTTGGGATCTTCGGTCTGAGCA
GGTTTACGAAATCCTGGGAGATGATCTGTCTCAATGGCTTCAGCTTCTTCAGGAAATTAGAAAGAGTCGGGCTAC
ATTCGATACTTCTGAAGTCAGCCGCGGCTTCGGAAATATCAGGATTGATTACGAGCAAGTCCAAACCAAGGTGAA
TGCCAAATACGACCAGTGGCAGCATGAGATCCTCGTGAAGTTTGGTTCTAAGCTTGGCGGCCGCATGAGAGAGGT
TCATTCCGAGATTGCTGCTGCCCGAAGGGACTTGGAAGGCCAAACCCTAGAGGCCTCTTCAACGGCGCATGCCGT
GTCTTTCATTACCATTGTTCAGCAGTGCAAGCGGAAGACTCGAGTCTGGGAGCCCGAGGTTGACCTCTTCCGTCA
AGGCCAAACCACACTCGCCCGCCAACGTTACCAGTTCCCGTATGACTGGCTTCACGTTGAGAATGTTGATGGTGA
ATGGGCAGCCCTTAACGAGCTGCTTAGCCGCAAGAGCAAAATTGTCAACGAGCAAACCGAAGCCTTGCGTGCAAA
GATTAGCGCTGAAGACCACGTCATTGCCGGCAAGATTGCCGAAGTTATCGGTAAATGGAATGATGAGAAGCCGGT
CTCTGGCACTATTCCACCCGAGGAAGCATCTCGCACCCTGAGCTCTTTCCAGTCTCGCCTCGAGGCTCTCCAGTC
TGAGTTTGAGATGGTCTCAAAGGCCAAGGAAGCTCTCGATCTTCCCCCAAGTTCCGAGTCATCACTTCCCCCCAT
CCTCGAGGAGGTCCAAGACTTCATGTCTGTCTGGGCTGCTCTAGCAACAATCTGGAACAGTCTTAATGACCTTCG
CGATGGGCTGTGGACCAGCGTGCAACCTAGGAAGCTCCGACAGTCTCTTGACAACTTGATCAAAATGACCAAGGA
GATGCCCAGTCGCATGAGACAGTATGCTGCCTTTGAACACATTCAGAATGTTCTTCGGCAGCTGCTGAAAGTCAA
CTCACTTTTGTCAGACATGAAATCCGAAGCCGTCAAGGAAAGACATTGGCACAAAATATACAAGAGTCTTAAACC
CGACAAGCGTTTCTCTCTTGTCTCTTTGACCCTTGGTGATGTCTGGGATTTACAACTCGCATCAAGCGATTCCAT
CATTCGTGCTATCATTGCACAGGCACAGGGTGAGATGGCATTGGAGGAATTCCTGAAGTCTGTTCGGGAGACATG
GCAGAACTATTCTCTGGACCTAGTACACTACCAGAACAAATGCCGTCTGATAAAAGGCTTTGACGACCTGTTCGC
CAAGTGCAGCGAAAATCTGAACTCCCTCCAGGCCATGAGACATTCTCCGTACTACAAAGAATTTGAAGAAGAAGC
TACATCATGGGAAGATAAACTGAACCGAGTCCATGTCCTTTTCGACGTATGGATCGACGTCCAGCGACAATGGGT
CTACCTGGAAGGCGTCTTTACCGGCAACGCAGACATCAAGCATCTTCTTCCTTTGGAGTCGGGCCGTTTCCAGAA
TATCAACTCGGAATTCTTTACTGTCATGAAGAAGGTGTACAAATCTCCGTTCGTTTTGGATATTCTCGCAATTGT
AGATGTTCAAAAGTCCTTGGAGAGACTGGCTGATTTGCTGAACAAAATCCAAAAGGCACTCGGTGAATATTTGGA
GCGTGAACGTGTCTCATTTCCTCGCTTTTACTTTGTTGGAGATGAGGACTTGTTGGAGATCATTGGTAACAGCAA
TGATATCTTCCGTGTCGCCAAGCATTTCAAGAAGATGTTCGCTGGGATGTCAGGCCTTGTCATGGATGACGATAA
CAATATTGTTGCATTTACCTCCAAGGAGGGCGAAGAAGTCCGTTTGAAGAAAGAGGTTAACCTCCTCAAGACTCC
TCGTATTAATGATTGGCTCTCCGCGCTAGAGAACAGCATGAAGTTGACTCTAGCAGAACTTCTCGGCGAGGCCGT
TGAACAATTTGGAGTTCTTTACCATAGCAGCGATGTGGACCGAACGGCTTTCAATGACTTCTTGTCTAACTACCC
TGCTCAGATTGTGGTCCTCGCCAGTCAGGTCACTTGGACCAACGCAGTGCAACATTCCTTGGAGGAAGGAGGTGC
AACCCTCCCTGCGTTGCACGGTTCCGAAGTTCGGATTCTCGAGTTGCTGGCTGCGACGGTGCTTGGTGAACTCGA
TCCGATCACTCGCAAGAAGTGTGAGCATATGATCACGGAATTCGTTCACCAGCGCGACTGCATCTCCAAGCTCAT
AAGTCTCAATGCCACAACGCCAACTCACTACCATTGGCTTCTCCAGATGCGTTATGTCTTCCACGATTCGGGCGA
TTTCTTGGAGCGCCTATATGTCCACATGGCCAACGCGAAGCTCGCCTATGGATTCGAGTATTTAGGTGTGCCTGA
GCGTCTTGTCCGCACGCCTCTCACAGATCGTTGTTTCCTCACCCTTACTCAGGCTCTTTGCCAGAGACTGGGTGG
TTCGCCATATGGCCCTGCTGGTACCGGTAAAACCGAGTCAGTCAAGGCATTGGGCCTGCAACTCGGTCGTTTCAC
CCTCGTCTTCTGTTGTGACGACACATTCGATTTCCAAGCAATGGGTCGAATTTTCCTCGGTATCTGTCAGGTTGG
AGCGTGGGGTTGCTTTGACGAGTTCAACCGTCTGGAAGAACGTATTTTGTCGGCCGTCTCTCAGCAGATCCAGAA
CATCCAGATTGGTCTGAAAACTGGCGGAGATGGCGACAAGGCCCAAATTGAACTCGTAGGAAGACGACTCGCTGT
GAACTCCAACACCGGAATTTTCATTACCATGAACCCTGGCTACGCTGGTCGTTCCAATTTGCCAGACAACTTGAA
GAAGCTGTTCCGCAGTGTTGCCATGTCCAAACCGGATAAGGAACTGATTGCTGAAGTGATGCTTTTCTCGCAAGG
TTTCAAGCAGGCCAAGTCTCTCTCCAAGCAGACAGTCCCCTTCTTCGACCACTGTGCTTCCCGACTTTCCAAGCA
GGCTCATTACGACTTCGGTCTCCGTGCATTGAAGAGTGTTCTTGTTAGCTCAGGCGGTCTCAAGCGCGCGCGTCT
GGCCAGTACCGAGGGAGATCTAGGCCCCGAGGATGTCATTGAACCTCAAATCATTGTTCAAAGTCTCCGGGAGAC
AATTGCTCCTAAGCTTATTCGAGAAGATGTGGAAATCATGCTGGAAATCCAGGTGGAAGACTTCGCTGGCGTGGA
TTATGTGCCTGCCAACTTCGAGAAACTCACCCAAGCGATCCGTGATATTGCTACCAAAGAGCAACATCTCGTCGA
CAGTGAGATGTGGATCACCAAGGCACTGCAACTCTATCAAATTCAATGCATCCACCATGGTGTTATGATGGTTGG
TAAGTCAGGAGCCGGTAAATCAACTGCCTGGAAGATTTTACTGCAAGCGATGCAGCGCATTGAGGGCGTTGAGGG
CGTCTCTCACATCATCGACTCTAAGGTCATGTCTAAGGAATCTCTCTATGGTAACCTTGACAGCACTACCCGTGA
ATGGACAGACGGTCTCTTCACTGGAATTCTGAGAAAGATCGTAGACAACCTCCGAGGCGAGGATAGCAAACGCCA
TTGGATTGTTTTCGACGGAGATGTTGACCCTGAATGGGTTGAGAACCTGAACAGTGTTCTAGATGACAACAAACT
CCTCACCCTTCCCAATGGAGAGCGTCTCAACCTACCTTCAAATGTTCGCATCATGTTTGAAGTTGAAAGCTTGAA
GTATGCCACGCTTGCCACAGTCAGTCGTTGCGGTATGGTGTGGTTCAATGCCGACACTGTTACTCCAACCATGAT
GATTTCCAACTACGTCGAAAGCCTCAGGACAAAGACATTCGAGGACCTGGATGAAGACAGTGCTCCCGCAGGGAC
AGCAGTAATCCGGACACAGGATGCCCAGGACACAGTTGCAACAATCCTCAAACAGTTCTTGGAGGTTGATGACCT
GGTTCTCAGAGCTTTGGTGGAAGCAAAGAAATACAACCATATCATGGAGTTCACGGATATCCGCGCCCTCAACAC
TCTCTTCAGCTTGTTGAACAAGGCCTGCCGAAACGTCCTCGAATACAATGTCCAGCATCCAGACTTCCCTCTGGA
CTCTGAACAGATTGAGTCCTACATGTCCAAGAAGCTTCTTCTGACGCTGGTCTGGTCTCTTACCGGTGATTGTCC
ACTAAGTGATCGCAAGGAGTTCGGAAAATACATCACTGGAATGTCTACTATCGATCTTCCACCGGACGGCGATTC
ATCTTTGATTGACTATGACGTTCTTCTTCCCAAGTCTGACTGGACTAGTTGGCATTCACAGGTGCCCACGATTGA
TATCAACACACATTCCGTCACTCAAACCGATGTCATTATCCCCACGGTCGATACTATCCGTCATGAAGATGTGTT
GTACTCGTGGCTTGCTGAGCATAAGCCTTTGTTGCTCTGCGGTCCTCCTGGATCCGGTAAGACCATGACATTGTT
CGCCGCGCTCCGAAAGCTCCCGAACATGGAGGTCGTTGGTCTCAACTTCTCGAGTGCCACCACACCTGACCTCCT
GATCAAGACCTTTGAGCAGTACTGTGAGTACAAGAAGACTCTTAATGGTGTGGTGATGTCTCCGAACCAGATCGG
CCGCTGGCTTGTCATTTTCTGCGACGAGATCAATCTTCCGGCCCCTGATCGCTACGGCACTCAGCGTGCCATCTC
ATTCCTGCGCCAACTTGTGGAGCAGAATGGCTTCTGGCGAACCACCGACAAGACCTGGGTCACCCTGGATCGCAT
TCAATTTGTTGGTGCCTGTAATCCTCCTACGGATGCTGGTCGTACACCGATGGCTGAGAGATTCCTGCGTCATGC
TCCCCTGATCATGGTCGACTACCCCGGCGAGATCTCTCTCAACCAAATCTATGGCACGTTCAACTCTGCTGTGCT
TAAGATCCTTCCGTTGCTGCGTGGATACTCCGAGGCCCTCACCAGGGCCATGGTTCAGTTCTACCTCGAATCCCA
AACCCGCTTCACGCCCCAAATCCAGCCCCACTACGTTTACTCGCCTCGTGAGCTCACTAGATGGGTTCGGGGTCT
GTATGAGGCCATCAAGCCATTGGAAACCCTTTCTGTTGAAGGCCTGGTCCGCATTTGGGCGCACGAAGCCCTGCG
TCTATTCCAGGACAGACTCGTGGATGAAGATGAGAGAGCTTGGACGGCAGATGCTGTTCGCCGCATTGCCTTGGA
ACATTTCCCTTCAATCGATGAACAAGAAGCATTGAAGGGTCCTATCCTGTTCTCCAACTGGCTGTCCAAGAACTA
CGTGCCTGTCGAACAGGAGAGTCTGCGTGAATTCGTGAAGGCACGTCTAAGAACCTTCTGCGAAGAAGAGGTGGA
TGTTCCGCTTGTGTTGTTCAACGATGTCCTTGAGCACGCGCTACGCATCGATCGAGTCTTCCGCCAGCCTCAAGG
TCATCTCATTCTTATCGGTGTGAGTGGAAGTGGAAAGACAACTCTGTCTCGCTTCGTCGCTTGGATGAATGGTTT
GAAGGTCTTCCAGATCAAGGTACACGGGAAGTACTCTTCGGAAGATTTCGATGACGATCTTCGCAGCGTTCTTCG
CCGGGCAGGATGCAAAGGCGAAAAGATTTGCTTTGTCATGGATGAATCAAACGTTCTTGACTCTGGATTCCTGGA
ACGCATGAATACTTTGCTTGCAAACGCAGAAGTCCCTGGTCTCTTTGAGGGCGACGAATTCTCCTCATTGATGAC
TGCTTGTAAAGAGGGTGCCCAGCGTCAAGGCTTGCTCCTAGATTCGCAGGAGGAGCTGTACAAGTGGTTCACCTC
GCAAATCGTTAAGAACCTGCACGTTGTCTTTACCATGAACCCGCCAGAGGAGGGTCTATCTTCAAAAGCAGCTAC
TAGTCCCGCCTTGTTCAATCGTTGTGTCCTGAACTGGATGGGTGACTGGTCTGACCAAGCCTTGTTCCAAGTTGG
CTCCGAGCTCACTCAATCGGTCGATCTAGACAAACCAAACTTCATCTCGCCTGATAGCATCCCAGTAGCATACCG
CGAGTTGACTCTCCCAGCATCACACAGAGACACTGTTGTCAATTCCATGGTGTTTATTCACCACTCCTTGCATCG
CTTCAATGGGCGGCTCCACAAACAACAGGGCCGGACGACTTTCCTCACCCCTCGCCATTATCTCGACTTTGTTGC
GCAGTATGTCAAGCTTTTCAACGAGAAGCGCGAGGATCTCGAGGAGCAACAACGTCACTTGAACATTGGTCTCGA
AAAGCTTCATGACACCGTCGACAAAGTGAGCGACCTTCGAGCTAGTCTCGCACAGAAGAAGACACAATTGGAGAA
GAAGGATACGGAAGCGAACGATAAATTGCAGCGTATGGTCGCTGATCAGCAAGAAGCAGAACAGCGGAAGCACGT
TTCATTGGAAGTGCAGGCCGCGTTAGAGATACAAGAGAAGGAAGTGGCAACTCGGAAAGAAGTCGTGTTGAACGA
TTTGGCCCGGGCTGAACCCGCTGTCCTGGAAGCCCAGAAGAGTGTCAGCAACATTAAACGTCAACACCTCACGGA
AGTTCGGTCCATGGGTAACCCTCCGGCTAGCGTCCGACTTGCCCTGGAAGCCGTATGCACACTCCTCGGACACAC
CGTCGATAGTTGGAAAACAATCCAAGGTCTCATTCGTCGGGATGATTTCATCGCCAGCATCGTTAACTACGACAA
TGAGCGCCAGATGACGCGCAGACACCGTACTAAGATGCAGAATGAATTCCTGTCGAAGGAAGACTTCACCTATGA
GCGAGTTAACCGTGCCAGTAAGGCCTGCGGTCCTTTAGTGCAATGGGTTGAAGCCCAGGTCAACTACTCTGCGAT
CCTTGATCGTGTTGGCCCTCTACGTGAAGAGGTGGATCAACTTGAGGAGCAGGCCCTGCAAACCAAGGCCGAAGC
TCAGGCCATCGAAAATACCATCAATGACCTCGAAACTAGCATCGCCACCTACAAGGCCGAGTACGCTGCCCTTAT
CAGCGAGACGCAGGCAATCAAGACCGAGATGAATCGGGTTCAATTCAAGGTCGACCGCAGTGTTCGTTTGCTTGA
TAGTTTGTCCTCTGAGCGTGGGCGCTGGGAAGAAGGGAGCAAGTCATTCGAAACTCAGATCAGCACTCTCGTTGG
CGATGTTCTCATTGCAGCTGCATTCCTTGCATATGCTGGTCTTTACGATCAGCAATTCCGTAAGGCAATGGCTGA
GGACTGGGTCCACCAACTGGCGGCATCTGGCATTCAATTCAAGCCTCACAATCCCATAACGGAATACTTGTCTAA
TGCCGATGAACGCTTGACCTGGCAGAGTCATTCTCTTCCCGTTGACGATCTTTGCACAGAGAACGCCATCATTCT
CAAGAGATTCAACAGATACCCGCTTATTGTTGATCCCTCTGGCCGTATTACAGAATTTTTACAGAAGGAAAGCAA
AGATCGCAAACTCACTGTCACGAGCTTCTTGGACGATTCCTTTGTCAAGCAATTGGAGAGCGCGTTGCGTTTCGG
AAACCCCATCCTTATCCAGGATGCCGAGCATCTGGACCCGATTCTCAATCACGTTCTCAACAAGGAATACCAGAA
AACTGGTGGTCGTGTCCTCATTCAATTGGGCAAGCAAGAAATCGATTTCTCGCCATCCTTCAAGCTCTTCCTATC
CACCCGGGATCCATCTGCCACATTCCCGCCGGATATTTGCAGTCGAACTACCTTCGTCAACTTCACTGTCACCCA
GAGCAGCTTGCAAACACAGTCTTTGAATGATGTCCTGAAATTCGAGCGGCCCGATGTCGATGAACGTCGCAACAA
CCTTGTCAAGATGCAAGGAGAGTTCAAGGTCCACCTTAGACAACTCGAGAAGCGTCTTTTGCAGGCGCTCAACGA
GTCCCGTGGTAACATTCTCGATGATGACAATGTCATTGAAACTCTTGAAACTCTCAAAAAGGAGGCTGCCGAGAT
TTCTCTGAAGATGGATCAAACCGAAGGTGTTATGCTCGAGGTGGACAACGTTACGCAGAACTACAGCATCATTGC
CCGTTCCTGCAGTGCCGTCTTTGCGGTTCTAGAACAACTTCACCACATCAATCACTTCTACCAGTTCTCTCTGCA
GTATTTCGTCGATATTTTCAATTCTGTTCTCTACCAGAACAAACGCCTTGCTCAGGAGAAGGATCATGCTGCGCG
TGTCCAGATTATTGTTAGGGACTTGTTCATCAACACCTATAAGCGAACCTCCCTTGGTCTCGTTCAAAAGGATCG
CATCACACTTGCCATTCTGCTTGCTCAAGCTACCCCATTCCCCATGGACAGGACCATTCTCGACCGCGTCCTGGA
TGAGACAGTGGAGGACGCGGATCTTTCAACTTCTGTGGACACTCGCGACCAAGTGATGACGAGGCTGGCCAACAT
GTCCCTCTTCAAAGAGCATATTCCAAACGTCACCCAAGAACAGTGGGATCGTTTCTTCGGCGAGGAGCTTGCAGA
GAACGTGGTCCCGGTTATGTGGGACGAGAGTGTGTCGCAACTGGATCAACTGCTTCGGTCCTTGCTCCTTGTCAA
GATTTGCCGCATGGACCGATTTGTTCCCAGTGCCGAGCGTTTCGTCGAGGCGGTGTTCGGCCGCGAGCTGTTCGA
GGGTGGTGCCGACCTAAAGGATGTAGTTGACCAGGTCACTGCAACCAGGCCCATCGCGCTCAGCTCCAGCCCTGG
CTTCGATGCCAGTTACAAGGTCGACGCTCTTGTTGAAGCCACCCGCGCAACCTGCGCCAACATTGCCATGGGATC
TAACGAAGGTCTCGAAAGCGCGGACAAGGCCATCAGCAACGCAGCTGCAGTCGGTAACTGGGTGCTGGTCAAGAA
CGTCCACCTGGCGCCTGCTTGGCTGCAAAGTCTCGAGAAGAGACTGGATTCTCTCAAACCACACAAGGAATTCCG
TCTTTTCCTATCTATGGAGTCCAGCCCTAAGATCCCTGTCAATTTGATCCGGGCCTCGCGTGTGCTGATGTACGA
ACAGCCCGCGGGTGTGCGTGCCAACATGAAGGATTCCCTCTCTTCGCTGAGTGTGAGAGCCAGCAAGCCTCCAGT
CGAAAAGGCCCGTGTCTATCTCTTACTCTGCTTCTTGCACGCCGTCGTCCAGGAAAGGCTCCGCTATGCACCAAG
CCTTGGATGGAAGGGCTTCTGGGAGTTCAACGACAGCGACGTAAGTACCCTACATCCATTTATTCCCCATAGAGA
CGCTAACATTTTCCCCTCAGTACGAGTGCTCAGCCCACATCATTGACTACTGGGTCGATTCAGTGTCCCAAGGCC
GTTCCAACGTGGCTCCGCAGAAGATTCCCTGGGAGATGATCCGCACTCTTGTCGCAGAGATGTACGGTGGTAAAA
TCGACGACGCAGGCGATTACCAGCAGCTCGAGAACCTGGTCAATAGCTTCCTTACACCCGCCGCCTTCGAAGATG
GCTACAAGCTCGTCTCGGGTGTAGAGAACGACAATCTTTTGACGCTGCCGGAGACCACTAGCATGCGCGAGTTCG
TCGTCTGGGTTAACAATCTGCCGGAGCGTGAACCCCCTACCTACCTGGGTCTCCCTGCCAATGCCGAGAAGCTCT
TGTTGGTCGGCCATGGCCGTAAGATGATTTCTGATCTCTCGCGGGTTACGACTCTTCTTGATGAAGGAGAGCAGT
TGATGGTCGATGCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail