Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g1578.t1
Gene name
Locationscaffold_02:333292..333861
Strand+
Gene length (bp)569
Transcript length (bp)369
Coding sequence length (bp)369
Protein length (aa) 123

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05129 Elf1 Transcription elongation factor Elf1 like 1.3E-29 2 79

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 13 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 737.22 452.50 1021.94
5d_25C Five days - 25 degrees Celsius 911.47 559.90 1263.04
7d_25C Seven days - 25 degrees Celsius 949.93 580.24 1319.63
10d_25C Ten days - 25 degrees Celsius 1287.84 783.88 1791.80
7d_15C Seven days - 15 degrees Celsius 830.99 508.02 1153.97
7d_30C Seven days - 30 degrees Celsius 855.74 518.11 1193.37

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.366522 no
3d_25C 7d_25C 0.267726 no
3d_25C 7d_15C 0.664931 no
3d_25C 7d_30C 0.575937 no
3d_25C 10d_25C 0.004450 yes
5d_25C 7d_25C 0.901671 no
5d_25C 7d_15C 0.747578 no
5d_25C 7d_30C 0.840349 no
5d_25C 10d_25C 0.109209 no
7d_25C 7d_15C 0.623762 no
7d_25C 7d_30C 0.720275 no
7d_25C 10d_25C 0.174346 no
7d_15C 7d_30C 0.932348 no
7d_15C 10d_25C 0.036293 yes
7d_30C 10d_25C 0.057236 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g1578.t1
MGKRKKSSSKPQGPKKREPLATTFSCLFCNHENSVVVKLDKKLGLGDLSCKVCGQKFQTGINYLSAPVDVYSDWV
DACDAVAKDTANQYDAPVSSHLGQRGISKQGISGETGQDDGYDDDEY*
Coding >Pro_DTO377G3_2|g1578.t1
ATGGGCAAGCGCAAGAAGTCAAGCTCCAAGCCCCAAGGGCCTAAGAAGAGGGAGCCTCTTGCTACCACATTCTCC
TGTCTCTTTTGCAACCATGAGAACTCTGTGGTCGTCAAGCTAGACAAGAAGCTTGGCCTTGGCGATCTATCGTGC
AAAGTTTGTGGTCAAAAGTTCCAAACCGGTATCAATTATCTTTCTGCTCCCGTGGATGTGTATTCAGATTGGGTA
GATGCATGTGATGCAGTTGCGAAGGACACTGCCAATCAGTATGATGCACCGGTTTCTAGTCACTTGGGACAGAGA
GGGATCAGCAAGCAGGGCATATCTGGAGAGACTGGGCAGGACGATGGCTACGATGATGATGAATACTGA
Transcript >Pro_DTO377G3_2|g1578.t1
ATGGGCAAGCGCAAGAAGTCAAGCTCCAAGCCCCAAGGGCCTAAGAAGAGGGAGCCTCTTGCTACCACATTCTCC
TGTCTCTTTTGCAACCATGAGAACTCTGTGGTCGTCAAGCTAGACAAGAAGCTTGGCCTTGGCGATCTATCGTGC
AAAGTTTGTGGTCAAAAGTTCCAAACCGGTATCAATTATCTTTCTGCTCCCGTGGATGTGTATTCAGATTGGGTA
GATGCATGTGATGCAGTTGCGAAGGACACTGCCAATCAGTATGATGCACCGGTTTCTAGTCACTTGGGACAGAGA
GGGATCAGCAAGCAGGGCATATCTGGAGAGACTGGGCAGGACGATGGCTACGATGATGATGAATACTGA
Gene >Pro_DTO377G3_2|g1578.t1
ATGGTACGTGCTATCGAATTTCCTTCCCCGACTGCCCTGACCCGCCCGACCCCCCCGACCGTGGATAGATGTTAA
TTTAAACAGGGCAAGCGCAAGAAGTCAAGCTCCAAGCCCCAAGGGCCTAAGAAGGTAAACGATTCACAAGTCGCC
AGGCTTTACACCCAGTACTGACTGTGAAATATAGAGGGAGCCTCTTGCTACCACATTCTCCTGTCTCTTTTGCAA
CCATGAGAACTCTGTGGTCGTCAAGCTAGACAAGAAGCTTGGCCTTGGCGATCTATCGTGCAAAGTTTGTGGTCA
AAAGTTCCAAACCGGTATCAATTGTGAGTCGATAATTCGGCCTAAGGCATCAGTCGTAACTGGTTTGACTAACAC
AATGCTTCAAAGATCTTTCTGCTCCCGTGGATGTGTATTCAGATTGGGTAGATGCATGTGATGCAGTTGCGAAGG
ACACTGCCAATCAGTATGATGCACCGGTTTCTAGTCACTTGGGACAGAGAGGGATCAGCAAGCAGGGCATATCTG
GAGAGACTGGGCAGGACGATGGCTACGATGATGATGAATACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail