Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g1561.t1
Gene name
Locationscaffold_02:297422..298024
Strand+
Gene length (bp)602
Transcript length (bp)474
Coding sequence length (bp)474
Protein length (aa) 158

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00462 Glutaredoxin Glutaredoxin 3.9E-15 60 127

GO

GO Term Description Terminal node
GO:0097573 glutathione oxidoreductase activity Yes
GO:0016491 oxidoreductase activity No
GO:0015035 protein-disulfide reductase activity No
GO:0140096 catalytic activity, acting on a protein No
GO:0015036 disulfide oxidoreductase activity No
GO:0016667 oxidoreductase activity, acting on a sulfur group of donors No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 332.18 202.10 462.26
5d_25C Five days - 25 degrees Celsius 347.77 211.39 484.14
7d_25C Seven days - 25 degrees Celsius 339.03 205.86 472.20
10d_25C Ten days - 25 degrees Celsius 438.62 268.98 608.25
7d_15C Seven days - 15 degrees Celsius 413.89 251.67 576.11
7d_30C Seven days - 30 degrees Celsius 308.79 187.14 430.44

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.887427 no
3d_25C 7d_25C 0.951591 no
3d_25C 7d_15C 0.373531 no
3d_25C 7d_30C 0.812202 no
3d_25C 10d_25C 0.219311 no
5d_25C 7d_25C 0.938696 no
5d_25C 7d_15C 0.507758 no
5d_25C 7d_30C 0.678412 no
5d_25C 10d_25C 0.327083 no
7d_25C 7d_15C 0.431152 no
7d_25C 7d_30C 0.754803 no
7d_25C 10d_25C 0.260297 no
7d_15C 7d_30C 0.201071 no
7d_15C 10d_25C 0.849695 no
7d_30C 10d_25C 0.099307 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g1561.t1
MFSRAVASAFRPVSRPTFLRPVRSAIRFPSGPAIPSVLHARLLSNETRTAIDKAVSSAPVVLFMKGTPETPQCGF
SRATIQILGLQGVDPKKFVAFNVLEDAELRSGVKEYSEWPTIPQLYVEKEFIGGCDILMSMHQNGELAKLLETKG
VLVAADE*
Coding >Pro_DTO377G3_2|g1561.t1
ATGTTTTCCAGAGCAGTTGCATCGGCTTTCCGCCCGGTCTCGCGGCCAACCTTTTTGCGGCCCGTCCGCTCCGCC
ATCCGATTCCCCTCGGGCCCTGCCATTCCCTCCGTCCTCCATGCACGCCTTCTGTCCAACGAGACCCGGACGGCG
ATCGATAAGGCGGTCTCTTCCGCCCCCGTCGTGCTGTTTATGAAGGGTACACCCGAGACTCCGCAGTGTGGTTTC
TCCCGCGCCACCATTCAAATCCTGGGTCTGCAGGGTGTTGATCCTAAGAAGTTTGTTGCTTTCAACGTGCTGGAG
GATGCAGAGCTGCGCTCAGGTGTCAAGGAATACTCTGAGTGGCCCACTATTCCCCAGCTATACGTCGAGAAGGAG
TTCATCGGTGGATGTGATATCCTAATGTCCATGCACCAAAATGGTGAGCTTGCTAAACTTTTGGAGACCAAGGGC
GTTCTGGTTGCGGCGGATGAATAA
Transcript >Pro_DTO377G3_2|g1561.t1
ATGTTTTCCAGAGCAGTTGCATCGGCTTTCCGCCCGGTCTCGCGGCCAACCTTTTTGCGGCCCGTCCGCTCCGCC
ATCCGATTCCCCTCGGGCCCTGCCATTCCCTCCGTCCTCCATGCACGCCTTCTGTCCAACGAGACCCGGACGGCG
ATCGATAAGGCGGTCTCTTCCGCCCCCGTCGTGCTGTTTATGAAGGGTACACCCGAGACTCCGCAGTGTGGTTTC
TCCCGCGCCACCATTCAAATCCTGGGTCTGCAGGGTGTTGATCCTAAGAAGTTTGTTGCTTTCAACGTGCTGGAG
GATGCAGAGCTGCGCTCAGGTGTCAAGGAATACTCTGAGTGGCCCACTATTCCCCAGCTATACGTCGAGAAGGAG
TTCATCGGTGGATGTGATATCCTAATGTCCATGCACCAAAATGGTGAGCTTGCTAAACTTTTGGAGACCAAGGGC
GTTCTGGTTGCGGCGGATGAATAA
Gene >Pro_DTO377G3_2|g1561.t1
ATGTTTTCCAGAGCAGTTGCATCGGTATGAACTGTTCTTTATTCTCGACATCCGCCATTCGCATCCCCCAGCTAA
CATGAATCTCGCAGGCTTTCCGCCCGGTCTCGCGGCCAACCTTTTTGCGGCCCGTCCGCTCCGCCATCCGATTCC
CCTCGGGCCCTGCCATTCCCTCCGTCCTCCATGCACGCCTTCTGTCCAACGAGACCCGGACGGCGATCGATAAGG
CGGTCTCTTCCGCCCCCGTCGTGCTGTTTATGAAGGGTACACCCGAGACTCCGCAGTGTGGTTTCTCCCGCGCCA
CCATTCAAATCCTGGGTCTGCAGGGTGTTGATCCTAAGAAGTTTGTTGCTTTCAACGTGCTGGAGGATGCAGAGC
TGCGCTCAGGTGTGTTGGGATTACCCCGAACTTCCTGCCGGCTATAGATTGCTAATCGTGCTGCATTTACAGGTG
TCAAGGAATACTCTGAGTGGCCCACTATTCCCCAGCTATACGTCGAGAAGGAGTTCATCGGTGGATGTGATATCC
TAATGTCCATGCACCAAAATGGTGAGCTTGCTAAACTTTTGGAGACCAAGGGCGTTCTGGTTGCGGCGGATGAAT
AA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail