Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g1542.t1
Gene name
Locationscaffold_02:247312..248002
Strand-
Gene length (bp)690
Transcript length (bp)690
Coding sequence length (bp)690
Protein length (aa) 230

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13649 Methyltransf_25 Methyltransferase domain 1.9E-18 57 150
PF08241 Methyltransf_11 Methyltransferase domain 2.6E-16 58 153
PF13847 Methyltransf_31 Methyltransferase domain 6.3E-11 54 173
PF13489 Methyltransf_23 Methyltransferase domain 7.2E-11 50 196
PF08242 Methyltransf_12 Methyltransferase domain 2.0E-10 58 152
PF01209 Ubie_methyltran ubiE/COQ5 methyltransferase family 2.0E-07 49 154
PF03141 Methyltransf_29 Putative S-adenosyl-L-methionine-dependent methyltransferase 4.1E-06 36 150
PF05175 MTS Methyltransferase small domain 8.7E-06 41 122
PF05401 NodS Nodulation protein S (NodS) 4.2E-05 51 153

GO

GO Term Description Terminal node
GO:0009312 oligosaccharide biosynthetic process Yes
GO:0009877 nodulation Yes
GO:0008168 methyltransferase activity Yes
GO:0008757 S-adenosylmethionine-dependent methyltransferase activity Yes
GO:0016740 transferase activity No
GO:0005975 carbohydrate metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:0016051 carbohydrate biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:0009058 biosynthetic process No
GO:0003824 catalytic activity No
GO:0008152 metabolic process No
GO:0051704 multi-organism process No
GO:0044403 symbiont process No
GO:0044419 interspecies interaction between organisms No
GO:0044238 primary metabolic process No
GO:0009311 oligosaccharide metabolic process No
GO:0003674 molecular_function No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 49 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g1542.t1
MPETTNHKIKSDIKKAYNEIASVYLTWTKPSHETRLSYLDLLLQSIHSAKETHQLNILELGCGAGVPCTQLLSSH
AHISITANDISSTQIALAKERLSPSVNLILGDMMELEFSAEQFDAVMAMYSIFHLPRMEQTTMLRRIFGWLKPGG
RLLANFSEAAFESSTNGSWLGATEGAMHWSGWGREEVRRVLVEIGFGIEVDEVTVDREEDNGGGKSVGFHWVLAR
KEKL*
Coding >Pro_DTO377G3_2|g1542.t1
ATGCCCGAAACCACCAACCACAAAATCAAATCCGACATCAAAAAAGCCTACAATGAAATCGCCTCAGTCTACCTA
ACCTGGACAAAACCCTCGCACGAAACCCGCCTCTCCTACCTCGACCTCCTCCTTCAATCCATCCACTCCGCAAAA
GAAACCCACCAACTCAACATCCTCGAGCTAGGCTGCGGCGCCGGCGTACCCTGCACCCAGCTGCTATCCTCACAC
GCCCACATTAGCATAACCGCAAATGACATATCATCGACACAAATCGCCCTGGCCAAAGAGCGACTCTCTCCCTCC
GTAAACCTGATCCTAGGCGACATGATGGAGCTGGAATTCAGCGCAGAGCAGTTCGACGCCGTGATGGCCATGTAT
TCCATTTTCCATCTGCCGCGCATGGAGCAGACTACGATGCTGCGTCGGATATTCGGCTGGTTGAAGCCTGGGGGC
CGGCTTCTGGCGAATTTCTCCGAGGCCGCGTTTGAGAGCTCGACTAATGGTTCTTGGTTGGGGGCTACGGAGGGC
GCTATGCATTGGAGTGGGTGGGGGAGGGAGGAGGTGAGGAGGGTTCTTGTTGAGATTGGGTTTGGGATTGAGGTT
GATGAGGTTACGGTGGATCGGGAAGAGGATAATGGAGGTGGGAAGAGTGTTGGGTTCCATTGGGTATTAGCTAGG
AAGGAAAAGTTATAG
Transcript >Pro_DTO377G3_2|g1542.t1
ATGCCCGAAACCACCAACCACAAAATCAAATCCGACATCAAAAAAGCCTACAATGAAATCGCCTCAGTCTACCTA
ACCTGGACAAAACCCTCGCACGAAACCCGCCTCTCCTACCTCGACCTCCTCCTTCAATCCATCCACTCCGCAAAA
GAAACCCACCAACTCAACATCCTCGAGCTAGGCTGCGGCGCCGGCGTACCCTGCACCCAGCTGCTATCCTCACAC
GCCCACATTAGCATAACCGCAAATGACATATCATCGACACAAATCGCCCTGGCCAAAGAGCGACTCTCTCCCTCC
GTAAACCTGATCCTAGGCGACATGATGGAGCTGGAATTCAGCGCAGAGCAGTTCGACGCCGTGATGGCCATGTAT
TCCATTTTCCATCTGCCGCGCATGGAGCAGACTACGATGCTGCGTCGGATATTCGGCTGGTTGAAGCCTGGGGGC
CGGCTTCTGGCGAATTTCTCCGAGGCCGCGTTTGAGAGCTCGACTAATGGTTCTTGGTTGGGGGCTACGGAGGGC
GCTATGCATTGGAGTGGGTGGGGGAGGGAGGAGGTGAGGAGGGTTCTTGTTGAGATTGGGTTTGGGATTGAGGTT
GATGAGGTTACGGTGGATCGGGAAGAGGATAATGGAGGTGGGAAGAGTGTTGGGTTCCATTGGGTATTAGCTAGG
AAGGAAAAGTTATAG
Gene >Pro_DTO377G3_2|g1542.t1
ATGCCCGAAACCACCAACCACAAAATCAAATCCGACATCAAAAAAGCCTACAATGAAATCGCCTCAGTCTACCTA
ACCTGGACAAAACCCTCGCACGAAACCCGCCTCTCCTACCTCGACCTCCTCCTTCAATCCATCCACTCCGCAAAA
GAAACCCACCAACTCAACATCCTCGAGCTAGGCTGCGGCGCCGGCGTACCCTGCACCCAGCTGCTATCCTCACAC
GCCCACATTAGCATAACCGCAAATGACATATCATCGACACAAATCGCCCTGGCCAAAGAGCGACTCTCTCCCTCC
GTAAACCTGATCCTAGGCGACATGATGGAGCTGGAATTCAGCGCAGAGCAGTTCGACGCCGTGATGGCCATGTAT
TCCATTTTCCATCTGCCGCGCATGGAGCAGACTACGATGCTGCGTCGGATATTCGGCTGGTTGAAGCCTGGGGGC
CGGCTTCTGGCGAATTTCTCCGAGGCCGCGTTTGAGAGCTCGACTAATGGTTCTTGGTTGGGGGCTACGGAGGGC
GCTATGCATTGGAGTGGGTGGGGGAGGGAGGAGGTGAGGAGGGTTCTTGTTGAGATTGGGTTTGGGATTGAGGTT
GATGAGGTTACGGTGGATCGGGAAGAGGATAATGGAGGTGGGAAGAGTGTTGGGTTCCATTGGGTATTAGCTAGG
AAGGAAAAGTTATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail