Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g1515.t1
Gene name
Locationscaffold_02:180452..182135
Strand+
Gene length (bp)1683
Transcript length (bp)1569
Coding sequence length (bp)1569
Protein length (aa) 523

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 6.1E-12 275 342

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0097159 organic cyclic compound binding No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0003676 nucleic acid binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 30 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 29.55 16.52 42.58
5d_25C Five days - 25 degrees Celsius 18.21 9.06 27.37
7d_25C Seven days - 25 degrees Celsius 17.03 8.24 25.83
10d_25C Ten days - 25 degrees Celsius 9.63 3.96 15.30
7d_15C Seven days - 15 degrees Celsius 16.41 7.92 24.90
7d_30C Seven days - 30 degrees Celsius 15.38 7.38 23.38

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.058289 no
3d_25C 7d_25C 0.037164 yes
3d_25C 7d_15C 0.023923 yes
3d_25C 7d_30C 0.010083 yes
3d_25C 10d_25C 0.000700 yes
5d_25C 7d_25C 0.872372 no
5d_25C 7d_15C 0.791790 no
5d_25C 7d_30C 0.634968 no
5d_25C 10d_25C 0.030646 yes
7d_25C 7d_15C 0.936179 no
7d_25C 7d_30C 0.801512 no
7d_25C 10d_25C 0.058634 no
7d_15C 7d_30C 0.881834 no
7d_15C 10d_25C 0.080143 no
7d_30C 10d_25C 0.138887 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g1515.t1
MAPDKRVSKRKAAPVAADSPAKKTKKVEAKPDETTKEAAPKSILKKNEKSTKPKAEKAAAPAKTNGEPTRQVKPR
KRAADFLTDEEPEEATAPVKADKKAEKKPAAKKSKKEEVEAAPAPKKAAAKKSKKEEAEATPASKKSKKEEVEAA
PASKKAAAKKSKKEEAEATPAPKKAAAKKAAPKPKKAEPVVESEEEDAEEDVSPADESEAENEGDDDQTEALIKG
FESSGDEDESDGEGYKEGEPIPKAPDTKKAERKLAKELRKNGPPEEPGTVYIGRIPHGFYEHQMKAYFSQFGEIT
KLRLSRNRLTGRSKHYAFIEFSSTTVAKIVADTMDNYLMYGHIVKCKFVPKEQLHPEIWKGANRRFKVTPWNRIE
KKRLVKGKTRDQWSKSIESEQKKRQDKQEKLKKALGYEFDLPQLKSVDDVPIQEAPKAVEAAEPTDTATEEPAKA
IEAPAPVEAPVEAPVEAPVEAPVPTDDTSKKVKKGKKETPKAAATESPAAKSPATKAKGKVTKKATKTKSKA*
Coding >Pro_DTO377G3_2|g1515.t1
ATGGCTCCCGATAAGAGAGTTTCAAAGCGCAAGGCTGCGCCTGTCGCCGCCGATTCACCCGCCAAAAAGACCAAG
AAGGTCGAGGCTAAGCCTGATGAGACAACCAAAGAGGCTGCTCCTAAGTCTATCTTGAAGAAGAATGAGAAGAGC
ACCAAGCCTAAGGCAGAGAAGGCTGCTGCGCCGGCCAAGACCAATGGCGAGCCCACTCGCCAGGTCAAGCCTCGC
AAGCGTGCTGCCGACTTCCTCACCGACGAGGAGCCCGAAGAGGCAACTGCGCCTGTGAAGGCCGACAAGAAGGCC
GAGAAGAAGCCTGCGGCTAAGAAGTCCAAGAAGGAGGAGGTCGAGGCCGCGCCCGCGCCCAAGAAGGCTGCCGCT
AAAAAGTCTAAGAAGGAGGAGGCTGAGGCCACCCCCGCTTCTAAAAAGTCCAAGAAGGAGGAGGTCGAGGCCGCG
CCCGCTTCCAAGAAGGCTGCCGCTAAAAAGTCTAAGAAGGAGGAGGCTGAGGCCACCCCCGCTCCCAAGAAGGCC
GCCGCGAAGAAGGCTGCCCCCAAGCCCAAGAAGGCCGAGCCCGTCGTTGAGTCCGAAGAGGAAGATGCCGAGGAG
GATGTCTCCCCTGCTGATGAGAGTGAGGCTGAGAACGAGGGTGATGACGACCAGACTGAGGCTCTGATCAAGGGC
TTCGAGAGCAGTGGCGACGAGGACGAGTCTGATGGTGAGGGTTACAAAGAGGGTGAACCTATCCCCAAGGCCCCA
GATACCAAGAAGGCCGAGCGCAAGCTGGCCAAGGAGCTGCGCAAGAACGGCCCCCCCGAGGAGCCCGGCACTGTT
TACATTGGACGTATCCCCCACGGTTTCTACGAGCACCAGATGAAGGCCTACTTCTCCCAATTTGGCGAAATCACC
AAACTCCGTCTTTCGCGCAACCGCCTCACCGGCCGCTCCAAGCACTACGCTTTCATTGAATTCTCCTCGACCACC
GTTGCCAAGATCGTCGCCGATACAATGGACAACTACCTTATGTATGGCCACATCGTCAAGTGCAAGTTCGTCCCC
AAAGAACAGCTGCACCCTGAGATTTGGAAGGGCGCCAACCGTCGCTTCAAGGTTACGCCATGGAACCGCATCGAG
AAGAAGCGTCTTGTGAAGGGCAAGACACGTGACCAGTGGTCGAAGAGTATCGAGTCCGAGCAGAAGAAGAGACAG
GACAAGCAGGAGAAGCTCAAGAAGGCCCTTGGTTACGAGTTTGATCTTCCCCAACTGAAGAGCGTCGACGATGTC
CCCATCCAAGAGGCCCCCAAGGCTGTCGAGGCCGCTGAGCCCACTGACACTGCCACCGAGGAGCCTGCCAAGGCC
ATCGAGGCCCCTGCTCCCGTTGAAGCCCCTGTTGAAGCTCCCGTTGAAGCCCCCGTTGAGGCTCCTGTCCCTACC
GATGATACCTCCAAGAAGGTCAAGAAGGGCAAGAAGGAGACACCCAAGGCGGCTGCTACAGAGTCACCGGCTGCT
AAGTCTCCTGCCACCAAGGCGAAGGGAAAGGTCACTAAGAAGGCCACCAAGACAAAGTCCAAGGCGTAA
Transcript >Pro_DTO377G3_2|g1515.t1
ATGGCTCCCGATAAGAGAGTTTCAAAGCGCAAGGCTGCGCCTGTCGCCGCCGATTCACCCGCCAAAAAGACCAAG
AAGGTCGAGGCTAAGCCTGATGAGACAACCAAAGAGGCTGCTCCTAAGTCTATCTTGAAGAAGAATGAGAAGAGC
ACCAAGCCTAAGGCAGAGAAGGCTGCTGCGCCGGCCAAGACCAATGGCGAGCCCACTCGCCAGGTCAAGCCTCGC
AAGCGTGCTGCCGACTTCCTCACCGACGAGGAGCCCGAAGAGGCAACTGCGCCTGTGAAGGCCGACAAGAAGGCC
GAGAAGAAGCCTGCGGCTAAGAAGTCCAAGAAGGAGGAGGTCGAGGCCGCGCCCGCGCCCAAGAAGGCTGCCGCT
AAAAAGTCTAAGAAGGAGGAGGCTGAGGCCACCCCCGCTTCTAAAAAGTCCAAGAAGGAGGAGGTCGAGGCCGCG
CCCGCTTCCAAGAAGGCTGCCGCTAAAAAGTCTAAGAAGGAGGAGGCTGAGGCCACCCCCGCTCCCAAGAAGGCC
GCCGCGAAGAAGGCTGCCCCCAAGCCCAAGAAGGCCGAGCCCGTCGTTGAGTCCGAAGAGGAAGATGCCGAGGAG
GATGTCTCCCCTGCTGATGAGAGTGAGGCTGAGAACGAGGGTGATGACGACCAGACTGAGGCTCTGATCAAGGGC
TTCGAGAGCAGTGGCGACGAGGACGAGTCTGATGGTGAGGGTTACAAAGAGGGTGAACCTATCCCCAAGGCCCCA
GATACCAAGAAGGCCGAGCGCAAGCTGGCCAAGGAGCTGCGCAAGAACGGCCCCCCCGAGGAGCCCGGCACTGTT
TACATTGGACGTATCCCCCACGGTTTCTACGAGCACCAGATGAAGGCCTACTTCTCCCAATTTGGCGAAATCACC
AAACTCCGTCTTTCGCGCAACCGCCTCACCGGCCGCTCCAAGCACTACGCTTTCATTGAATTCTCCTCGACCACC
GTTGCCAAGATCGTCGCCGATACAATGGACAACTACCTTATGTATGGCCACATCGTCAAGTGCAAGTTCGTCCCC
AAAGAACAGCTGCACCCTGAGATTTGGAAGGGCGCCAACCGTCGCTTCAAGGTTACGCCATGGAACCGCATCGAG
AAGAAGCGTCTTGTGAAGGGCAAGACACGTGACCAGTGGTCGAAGAGTATCGAGTCCGAGCAGAAGAAGAGACAG
GACAAGCAGGAGAAGCTCAAGAAGGCCCTTGGTTACGAGTTTGATCTTCCCCAACTGAAGAGCGTCGACGATGTC
CCCATCCAAGAGGCCCCCAAGGCTGTCGAGGCCGCTGAGCCCACTGACACTGCCACCGAGGAGCCTGCCAAGGCC
ATCGAGGCCCCTGCTCCCGTTGAAGCCCCTGTTGAAGCTCCCGTTGAAGCCCCCGTTGAGGCTCCTGTCCCTACC
GATGATACCTCCAAGAAGGTCAAGAAGGGCAAGAAGGAGACACCCAAGGCGGCTGCTACAGAGTCACCGGCTGCT
AAGTCTCCTGCCACCAAGGCGAAGGGAAAGGTCACTAAGAAGGCCACCAAGACAAAGTCCAAGGCGTAA
Gene >Pro_DTO377G3_2|g1515.t1
ATGGCTCCCGATAAGAGAGTTTCAAAGCGCAAGGGTATGTACAATGGTTTTGGTTGGCGAAATTCTCTTTCCTTT
CACTAACGATACTACAGCTGCGCCTGTCGCCGCCGATTCACCCGCCAAAAAGACCAAGAAGGTCGAGGCTAAGCC
TGATGAGACAACCAAAGAGGCTGCTCCTAAGTCTATCTTGAAGAAGAATGAGAAGAGCACCAAGCCTAAGGCAGA
GAAGGCTGCTGCGCCGGCCAAGACCAATGGCGAGCCCACTCGCCAGGTCAAGCCTCGCAAGCGTGCTGCCGACTT
CCTCACCGACGAGGAGCCCGAAGAGGCAACTGCGCCTGTGAAGGCCGACAAGAAGGCCGAGAAGAAGCCTGCGGC
TAAGAAGTCCAAGAAGGAGGAGGTCGAGGCCGCGCCCGCGCCCAAGAAGGCTGCCGCTAAAAAGTCTAAGAAGGA
GGAGGCTGAGGCCACCCCCGCTTCTAAAAAGTCCAAGAAGGAGGAGGTCGAGGCCGCGCCCGCTTCCAAGAAGGC
TGCCGCTAAAAAGTCTAAGAAGGAGGAGGCTGAGGCCACCCCCGCTCCCAAGAAGGCCGCCGCGAAGAAGGCTGC
CCCCAAGCCCAAGAAGGCCGAGCCCGTCGTTGAGTCCGAAGAGGAAGATGCCGAGGAGGATGTCTCCCCTGCTGA
TGAGAGTGAGGCTGAGAACGAGGGTGATGACGACCAGACTGAGGCTCTGATCAAGGGCTTCGAGAGCAGTGGCGA
CGAGGACGAGTCTGATGGTGAGGGTTACAAAGAGGGTGAACCTATCCCCAAGGCCCCAGATACCAAGAAGGCCGA
GCGCAAGCTGGCCAAGGAGCTGCGCAAGAACGGCCCCCCCGAGGAGCCCGGCACTGTTTACATTGGGTGAGTTTC
GACCGTAATTCATGATCATTTTGAACCATCTAACATTTCATTTCCAGACGTATCCCCCACGGTTTCTACGAGCAC
CAGATGAAGGCCTACTTCTCCCAATTTGGCGAAATCACCAAACTCCGTCTTTCGCGCAACCGCCTCACCGGCCGC
TCCAAGCACTACGCTTTCATTGAATTCTCCTCGACCACCGTTGCCAAGATCGTCGCCGATACAATGGACAACTAC
CTTATGTATGGCCACATCGTCAAGTGCAAGTTCGTCCCCAAAGAACAGCTGCACCCTGAGATTTGGAAGGGCGCC
AACCGTCGCTTCAAGGTTACGCCATGGAACCGCATCGAGAAGAAGCGTCTTGTGAAGGGCAAGACACGTGACCAG
TGGTCGAAGAGTATCGAGTCCGAGCAGAAGAAGAGACAGGACAAGCAGGAGAAGCTCAAGAAGGCCCTTGGTTAC
GAGTTTGATCTTCCCCAACTGAAGAGCGTCGACGATGTCCCCATCCAAGAGGCCCCCAAGGCTGTCGAGGCCGCT
GAGCCCACTGACACTGCCACCGAGGAGCCTGCCAAGGCCATCGAGGCCCCTGCTCCCGTTGAAGCCCCTGTTGAA
GCTCCCGTTGAAGCCCCCGTTGAGGCTCCTGTCCCTACCGATGATACCTCCAAGAAGGTCAAGAAGGGCAAGAAG
GAGACACCCAAGGCGGCTGCTACAGAGTCACCGGCTGCTAAGTCTCCTGCCACCAAGGCGAAGGGAAAGGTCACT
AAGAAGGCCACCAAGACAAAGTCCAAGGCGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail