Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g151.t1
Gene name
Locationscaffold_01:385161..385440
Strand+
Gene length (bp)279
Transcript length (bp)279
Coding sequence length (bp)279
Protein length (aa) 93

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 27 0.5

Transmembrane Domains

Domain # Start End Length
1 29 51 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 83.51 26.76 140.26
5d_25C Five days - 25 degrees Celsius 127.90 49.61 206.18
7d_25C Seven days - 25 degrees Celsius 163.58 68.74 258.42
10d_25C Ten days - 25 degrees Celsius 295.24 146.86 443.61
7d_15C Seven days - 15 degrees Celsius 108.49 29.93 187.05
7d_30C Seven days - 30 degrees Celsius 343.01 176.21 509.80

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.269896 no
3d_25C 7d_25C 0.053498 no
3d_25C 7d_15C 0.588085 no
3d_25C 7d_30C 0.000700 yes
3d_25C 10d_25C 0.000700 yes
5d_25C 7d_25C 0.541525 no
5d_25C 7d_15C 0.739466 no
5d_25C 7d_30C 0.000700 yes
5d_25C 10d_25C 0.004840 yes
7d_25C 7d_15C 0.302605 no
7d_25C 7d_30C 0.009770 yes
7d_25C 10d_25C 0.039770 yes
7d_15C 7d_30C 0.000700 yes
7d_15C 10d_25C 0.004045 yes
7d_30C 10d_25C 0.677584 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g151.t1
MALSLSASLKTSLLNCGTLISERLEAAPFQTFLLLASVWILSIPTLVFLMTRYWPSFNSKKAKPELRRSRENTDA
SETPAGTPIQTPSENKD*
Coding >Pro_DTO377G3_2|g151.t1
ATGGCACTGTCACTGTCAGCTTCACTTAAAACATCCCTACTAAACTGCGGAACCTTGATCAGTGAAAGACTCGAA
GCAGCTCCATTCCAGACCTTCCTACTCTTGGCATCTGTGTGGATACTCTCTATCCCGACTCTTGTGTTTTTGATG
ACCCGCTACTGGCCCTCGTTTAACTCCAAAAAGGCCAAACCTGAACTGCGACGCTCGCGCGAGAACACCGATGCC
AGTGAGACCCCTGCGGGGACCCCTATTCAAACCCCGAGTGAGAATAAGGATTGA
Transcript >Pro_DTO377G3_2|g151.t1
ATGGCACTGTCACTGTCAGCTTCACTTAAAACATCCCTACTAAACTGCGGAACCTTGATCAGTGAAAGACTCGAA
GCAGCTCCATTCCAGACCTTCCTACTCTTGGCATCTGTGTGGATACTCTCTATCCCGACTCTTGTGTTTTTGATG
ACCCGCTACTGGCCCTCGTTTAACTCCAAAAAGGCCAAACCTGAACTGCGACGCTCGCGCGAGAACACCGATGCC
AGTGAGACCCCTGCGGGGACCCCTATTCAAACCCCGAGTGAGAATAAGGATTGA
Gene >Pro_DTO377G3_2|g151.t1
ATGGCACTGTCACTGTCAGCTTCACTTAAAACATCCCTACTAAACTGCGGAACCTTGATCAGTGAAAGACTCGAA
GCAGCTCCATTCCAGACCTTCCTACTCTTGGCATCTGTGTGGATACTCTCTATCCCGACTCTTGTGTTTTTGATG
ACCCGCTACTGGCCCTCGTTTAACTCCAAAAAGGCCAAACCTGAACTGCGACGCTCGCGCGAGAACACCGATGCC
AGTGAGACCCCTGCGGGGACCCCTATTCAAACCCCGAGTGAGAATAAGGATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail