Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g1509.t1
Gene name
Locationscaffold_02:168814..170246
Strand+
Gene length (bp)1432
Transcript length (bp)1377
Coding sequence length (bp)1377
Protein length (aa) 459

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00108 Thiolase_N Thiolase, N-terminal domain 5.9E-17 12 231
PF02803 Thiolase_C Thiolase, C-terminal domain 2.7E-11 274 365

GO

GO Term Description Terminal node
GO:0016747 acyltransferase activity, transferring groups other than amino-acyl groups Yes
GO:0016746 acyltransferase activity No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 13 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 81.29 49.46 113.11
5d_25C Five days - 25 degrees Celsius 82.78 50.12 115.43
7d_25C Seven days - 25 degrees Celsius 74.65 44.70 104.59
10d_25C Ten days - 25 degrees Celsius 79.10 48.18 110.02
7d_15C Seven days - 15 degrees Celsius 75.61 45.94 105.27
7d_30C Seven days - 30 degrees Celsius 73.43 44.69 102.16

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.958008 no
3d_25C 7d_25C 0.780378 no
3d_25C 7d_15C 0.814867 no
3d_25C 7d_30C 0.726236 no
3d_25C 10d_25C 0.937460 no
5d_25C 7d_25C 0.728118 no
5d_25C 7d_15C 0.759770 no
5d_25C 7d_30C 0.671546 no
5d_25C 10d_25C 0.890348 no
7d_25C 7d_15C 0.972323 no
7d_25C 7d_30C 0.963742 no
7d_25C 10d_25C 0.858164 no
7d_15C 7d_30C 0.933134 no
7d_15C 10d_25C 0.891003 no
7d_30C 10d_25C 0.809461 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g1509.t1
MGKKQGTPAYVLGVGMTKFIKPRGKVDYHELGYEAGIKAMLDAKINYDDVDQGIACYVYGDSTCGQRVFYQFGQT
SIPIYNVNNNCSTGSTGLAMARNMVSHGVADCVLVVGFEKMNPGSLQSMYNDRENPTSLFGKMMAETRGMTNAPG
AAQMFGNAGREYKEKYGAKNEDFAEIARINHEHSKRNPYSQFQTEYTLEQIINAPMIYEPLTKLQCCPTSDGGAA
AVIVSQEFLDARPHLKEHAILIAGQCLATDDDTVYSKSSIDLMGFGMTRRACRTAVAEAGVNVKDIKVCELHDCF
SANEMITIDALELSEPGQAHEMVRRGDITYGGKMVINPSGGLISKGHPLGATGIAQCAELVWHLRGWANNRLVDG
TSAALQHNLGLGGAVVVTVYKRTDGKAATAVTSDVVGKINGLGYNPAVEAKGFTAEQAKSVVSKTHSSQYALSDT
QERVLARF*
Coding >Pro_DTO377G3_2|g1509.t1
ATGGGCAAGAAGCAAGGAACCCCCGCTTATGTACTGGGCGTTGGCATGACCAAGTTCATCAAGCCACGCGGTAAG
GTCGACTACCATGAGCTCGGCTATGAGGCTGGTATTAAAGCCATGCTCGACGCCAAGATCAACTATGACGATGTT
GACCAGGGCATTGCATGCTACGTCTACGGCGACAGCACCTGCGGCCAGCGCGTCTTCTACCAGTTCGGCCAGACC
AGCATCCCTATCTACAACGTCAACAACAACTGTTCGACCGGCTCGACTGGCCTCGCCATGGCCCGCAATATGGTT
TCCCATGGTGTTGCGGACTGTGTGCTGGTCGTCGGCTTCGAGAAGATGAACCCCGGTAGCTTGCAATCCATGTAC
AACGATCGGGAGAACCCAACGTCACTGTTTGGGAAGATGATGGCCGAGACGCGAGGTATGACGAACGCGCCCGGT
GCCGCACAGATGTTTGGAAACGCAGGTAGGGAATATAAGGAGAAGTACGGTGCTAAGAACGAGGACTTCGCCGAG
ATCGCCCGCATCAACCACGAGCACTCCAAGCGGAACCCCTACTCGCAATTCCAGACCGAATATACCCTCGAGCAG
ATCATAAACGCGCCCATGATCTACGAGCCTCTGACCAAGCTACAGTGCTGCCCAACCTCGGATGGCGGTGCCGCC
GCCGTTATTGTCTCGCAGGAGTTCCTCGATGCGCGTCCCCACCTGAAAGAACATGCCATTCTCATCGCCGGTCAG
TGTCTAGCCACCGATGACGACACAGTCTACAGCAAGAGCTCCATTGACCTGATGGGCTTCGGCATGACGCGTCGG
GCGTGCCGCACTGCCGTAGCCGAGGCCGGCGTGAATGTCAAGGATATCAAGGTTTGCGAGCTGCATGATTGCTTC
TCGGCCAATGAGATGATTACTATTGATGCGCTGGAGCTGAGTGAACCCGGCCAGGCCCATGAGATGGTCCGCCGT
GGCGATATCACGTACGGCGGAAAGATGGTCATCAACCCATCTGGCGGTCTCATCTCCAAGGGTCACCCGCTTGGT
GCTACGGGTATTGCGCAGTGTGCTGAGCTGGTCTGGCACCTGCGTGGCTGGGCCAACAATCGCCTGGTTGACGGT
ACTTCCGCGGCACTGCAGCACAACCTCGGTCTGGGCGGTGCCGTTGTCGTCACCGTCTACAAGCGTACTGATGGC
AAGGCCGCCACGGCTGTGACATCAGACGTCGTTGGCAAAATCAACGGTTTGGGCTATAACCCAGCTGTGGAGGCT
AAGGGCTTCACTGCCGAGCAGGCCAAGTCCGTCGTGAGCAAGACGCACAGCTCTCAGTATGCCCTGTCAGATACC
CAAGAGCGGGTCCTTGCCAGGTTCTAG
Transcript >Pro_DTO377G3_2|g1509.t1
ATGGGCAAGAAGCAAGGAACCCCCGCTTATGTACTGGGCGTTGGCATGACCAAGTTCATCAAGCCACGCGGTAAG
GTCGACTACCATGAGCTCGGCTATGAGGCTGGTATTAAAGCCATGCTCGACGCCAAGATCAACTATGACGATGTT
GACCAGGGCATTGCATGCTACGTCTACGGCGACAGCACCTGCGGCCAGCGCGTCTTCTACCAGTTCGGCCAGACC
AGCATCCCTATCTACAACGTCAACAACAACTGTTCGACCGGCTCGACTGGCCTCGCCATGGCCCGCAATATGGTT
TCCCATGGTGTTGCGGACTGTGTGCTGGTCGTCGGCTTCGAGAAGATGAACCCCGGTAGCTTGCAATCCATGTAC
AACGATCGGGAGAACCCAACGTCACTGTTTGGGAAGATGATGGCCGAGACGCGAGGTATGACGAACGCGCCCGGT
GCCGCACAGATGTTTGGAAACGCAGGTAGGGAATATAAGGAGAAGTACGGTGCTAAGAACGAGGACTTCGCCGAG
ATCGCCCGCATCAACCACGAGCACTCCAAGCGGAACCCCTACTCGCAATTCCAGACCGAATATACCCTCGAGCAG
ATCATAAACGCGCCCATGATCTACGAGCCTCTGACCAAGCTACAGTGCTGCCCAACCTCGGATGGCGGTGCCGCC
GCCGTTATTGTCTCGCAGGAGTTCCTCGATGCGCGTCCCCACCTGAAAGAACATGCCATTCTCATCGCCGGTCAG
TGTCTAGCCACCGATGACGACACAGTCTACAGCAAGAGCTCCATTGACCTGATGGGCTTCGGCATGACGCGTCGG
GCGTGCCGCACTGCCGTAGCCGAGGCCGGCGTGAATGTCAAGGATATCAAGGTTTGCGAGCTGCATGATTGCTTC
TCGGCCAATGAGATGATTACTATTGATGCGCTGGAGCTGAGTGAACCCGGCCAGGCCCATGAGATGGTCCGCCGT
GGCGATATCACGTACGGCGGAAAGATGGTCATCAACCCATCTGGCGGTCTCATCTCCAAGGGTCACCCGCTTGGT
GCTACGGGTATTGCGCAGTGTGCTGAGCTGGTCTGGCACCTGCGTGGCTGGGCCAACAATCGCCTGGTTGACGGT
ACTTCCGCGGCACTGCAGCACAACCTCGGTCTGGGCGGTGCCGTTGTCGTCACCGTCTACAAGCGTACTGATGGC
AAGGCCGCCACGGCTGTGACATCAGACGTCGTTGGCAAAATCAACGGTTTGGGCTATAACCCAGCTGTGGAGGCT
AAGGGCTTCACTGCCGAGCAGGCCAAGTCCGTCGTGAGCAAGACGCACAGCTCTCAGTATGCCCTGTCAGATACC
CAAGAGCGGGTCCTTGCCAGGTTCTAG
Gene >Pro_DTO377G3_2|g1509.t1
ATGGGCAAGAAGCAAGGAACCCCCGCTTATGTACTGGGCGTTGGCATGACCAAGTTCATCAAGCCACGCGGTAAG
GTCGACTACCATGAGCTCGGCTATGAGGCTGGTATTAAAGCCATGCTCGACGCCAAGATCAACTATGACGATGTT
GACCAGGGCATTGCATGCTACGTCTACGGCGACAGCACCTGCGGCCAGCGCGTCTTCTACCAGTTCGGCCAGACC
AGCATCCCTATCTACAACGTCAACAACAACTGTTCGACCGGCTCGACTGGCCTCGCCATGGCCCGCAATATGGTT
TCCCATGGTGTTGCGGACTGTGTGCTGGTCGTCGGCTTCGAGAAGATGAACCCCGGTAGCTTGCAATCCATGTAC
AACGATCGGGAGAACCCAACGTCACTGTTTGGGAAGATGATGGCCGAGACGCGAGGTATGACGAACGCGCCCGGT
GCCGCACAGATGTTTGGAAACGCAGGTAGGGAATATAAGGAGAAGTACACAACCTCTGGAGTAACAAGAAAGGAT
ATCATGCTAACATGCGAAAAACAGGTACGGTGCTAAGAACGAGGACTTCGCCGAGATCGCCCGCATCAACCACGA
GCACTCCAAGCGGAACCCCTACTCGCAATTCCAGACCGAATATACCCTCGAGCAGATCATAAACGCGCCCATGAT
CTACGAGCCTCTGACCAAGCTACAGTGCTGCCCAACCTCGGATGGCGGTGCCGCCGCCGTTATTGTCTCGCAGGA
GTTCCTCGATGCGCGTCCCCACCTGAAAGAACATGCCATTCTCATCGCCGGTCAGTGTCTAGCCACCGATGACGA
CACAGTCTACAGCAAGAGCTCCATTGACCTGATGGGCTTCGGCATGACGCGTCGGGCGTGCCGCACTGCCGTAGC
CGAGGCCGGCGTGAATGTCAAGGATATCAAGGTTTGCGAGCTGCATGATTGCTTCTCGGCCAATGAGATGATTAC
TATTGATGCGCTGGAGCTGAGTGAACCCGGCCAGGCCCATGAGATGGTCCGCCGTGGCGATATCACGTACGGCGG
AAAGATGGTCATCAACCCATCTGGCGGTCTCATCTCCAAGGGTCACCCGCTTGGTGCTACGGGTATTGCGCAGTG
TGCTGAGCTGGTCTGGCACCTGCGTGGCTGGGCCAACAATCGCCTGGTTGACGGTACTTCCGCGGCACTGCAGCA
CAACCTCGGTCTGGGCGGTGCCGTTGTCGTCACCGTCTACAAGCGTACTGATGGCAAGGCCGCCACGGCTGTGAC
ATCAGACGTCGTTGGCAAAATCAACGGTTTGGGCTATAACCCAGCTGTGGAGGCTAAGGGCTTCACTGCCGAGCA
GGCCAAGTCCGTCGTGAGCAAGACGCACAGCTCTCAGTATGCCCTGTCAGATACCCAAGAGCGGGTCCTTGCCAG
GTTCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail