Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g1509.t1
Gene name
Locationscaffold_02:168814..170246
Strand+
Gene length (bp)1432
Transcript length (bp)1377
Coding sequence length (bp)1377
Protein length (aa) 459

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00108 Thiolase_N Thiolase, N-terminal domain 5.9E-17 12 231
PF02803 Thiolase_C Thiolase, C-terminal domain 2.4E-11 274 365
PF08545 ACP_syn_III 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III 4.3E-05 81 117

GO

GO Term Description Terminal node
GO:0016747 transferase activity, transferring acyl groups other than amino-acyl groups Yes
GO:0006633 fatty acid biosynthetic process Yes
GO:0004315 3-oxoacyl-[acyl-carrier-protein] synthase activity Yes
GO:0043436 oxoacid metabolic process No
GO:0006631 fatty acid metabolic process No
GO:0072330 monocarboxylic acid biosynthetic process No
GO:0008610 lipid biosynthetic process No
GO:0019752 carboxylic acid metabolic process No
GO:0016740 transferase activity No
GO:0071704 organic substance metabolic process No
GO:0046394 carboxylic acid biosynthetic process No
GO:0016746 transferase activity, transferring acyl groups No
GO:0003824 catalytic activity No
GO:0044283 small molecule biosynthetic process No
GO:0044238 primary metabolic process No
GO:0009987 cellular process No
GO:0044237 cellular metabolic process No
GO:0032787 monocarboxylic acid metabolic process No
GO:0006082 organic acid metabolic process No
GO:0044249 cellular biosynthetic process No
GO:0008152 metabolic process No
GO:0044281 small molecule metabolic process No
GO:0008150 biological_process No
GO:0003674 molecular_function No
GO:1901576 organic substance biosynthetic process No
GO:0004312 fatty acid synthase activity No
GO:0006629 lipid metabolic process No
GO:0009058 biosynthetic process No
GO:0016053 organic acid biosynthetic process No
GO:0044255 cellular lipid metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 13 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g1509.t1
MGKKQGTPAYVLGVGMTKFIKPRGKVDYHELGYEAGIKAMLDAKINYDDVDQGIACYVYGDSTCGQRVFYQFGQT
SIPIYNVNNNCSTGSTGLAMARNMVSHGVADCVLVVGFEKMNPGSLQSMYNDRENPTSLFGKMMAETRGMTNAPG
AAQMFGNAGREYKEKYGAKNEDFAEIARINHEHSKRNPYSQFQTEYTLEQIINAPMIYEPLTKLQCCPTSDGGAA
AVIVSQEFLDARPHLKEHAILIAGQCLATDDDTVYSKSSIDLMGFGMTRRACRTAVAEAGVNVKDIKVCELHDCF
SANEMITIDALELSEPGQAHEMVRRGDITYGGKMVINPSGGLISKGHPLGATGIAQCAELVWHLRGWANNRLVDG
TSAALQHNLGLGGAVVVTVYKRTDGKAATAVTSDVVGKINGLGYNPAVEAKGFTAEQAKSVVSKTHSSQYALSDT
QERVLARF*
Coding >Pro_DTO377G3_2|g1509.t1
ATGGGCAAGAAGCAAGGAACCCCCGCTTATGTACTGGGCGTTGGCATGACCAAGTTCATCAAGCCACGCGGTAAG
GTCGACTACCATGAGCTCGGCTATGAGGCTGGTATTAAAGCCATGCTCGACGCCAAGATCAACTATGACGATGTT
GACCAGGGCATTGCATGCTACGTCTACGGCGACAGCACCTGCGGCCAGCGCGTCTTCTACCAGTTCGGCCAGACC
AGCATCCCTATCTACAACGTCAACAACAACTGTTCGACCGGCTCGACTGGCCTCGCCATGGCCCGCAATATGGTT
TCCCATGGTGTTGCGGACTGTGTGCTGGTCGTCGGCTTCGAGAAGATGAACCCCGGTAGCTTGCAATCCATGTAC
AACGATCGGGAGAACCCAACGTCACTGTTTGGGAAGATGATGGCCGAGACGCGAGGTATGACGAACGCGCCCGGT
GCCGCACAGATGTTTGGAAACGCAGGTAGGGAATATAAGGAGAAGTACGGTGCTAAGAACGAGGACTTCGCCGAG
ATCGCCCGCATCAACCACGAGCACTCCAAGCGGAACCCCTACTCGCAATTCCAGACCGAATATACCCTCGAGCAG
ATCATAAACGCGCCCATGATCTACGAGCCTCTGACCAAGCTACAGTGCTGCCCAACCTCGGATGGCGGTGCCGCC
GCCGTTATTGTCTCGCAGGAGTTCCTCGATGCGCGTCCCCACCTGAAAGAACATGCCATTCTCATCGCCGGTCAG
TGTCTAGCCACCGATGACGACACAGTCTACAGCAAGAGCTCCATTGACCTGATGGGCTTCGGCATGACGCGTCGG
GCGTGCCGCACTGCCGTAGCCGAGGCCGGCGTGAATGTCAAGGATATCAAGGTTTGCGAGCTGCATGATTGCTTC
TCGGCCAATGAGATGATTACTATTGATGCGCTGGAGCTGAGTGAACCCGGCCAGGCCCATGAGATGGTCCGCCGT
GGCGATATCACGTACGGCGGAAAGATGGTCATCAACCCATCTGGCGGTCTCATCTCCAAGGGTCACCCGCTTGGT
GCTACGGGTATTGCGCAGTGTGCTGAGCTGGTCTGGCACCTGCGTGGCTGGGCCAACAATCGCCTGGTTGACGGT
ACTTCCGCGGCACTGCAGCACAACCTCGGTCTGGGCGGTGCCGTTGTCGTCACCGTCTACAAGCGTACTGATGGC
AAGGCCGCCACGGCTGTGACATCAGACGTCGTTGGCAAAATCAACGGTTTGGGCTATAACCCAGCTGTGGAGGCT
AAGGGCTTCACTGCCGAGCAGGCCAAGTCCGTCGTGAGCAAGACGCACAGCTCTCAGTATGCCCTGTCAGATACC
CAAGAGCGGGTCCTTGCCAGGTTCTAG
Transcript >Pro_DTO377G3_2|g1509.t1
ATGGGCAAGAAGCAAGGAACCCCCGCTTATGTACTGGGCGTTGGCATGACCAAGTTCATCAAGCCACGCGGTAAG
GTCGACTACCATGAGCTCGGCTATGAGGCTGGTATTAAAGCCATGCTCGACGCCAAGATCAACTATGACGATGTT
GACCAGGGCATTGCATGCTACGTCTACGGCGACAGCACCTGCGGCCAGCGCGTCTTCTACCAGTTCGGCCAGACC
AGCATCCCTATCTACAACGTCAACAACAACTGTTCGACCGGCTCGACTGGCCTCGCCATGGCCCGCAATATGGTT
TCCCATGGTGTTGCGGACTGTGTGCTGGTCGTCGGCTTCGAGAAGATGAACCCCGGTAGCTTGCAATCCATGTAC
AACGATCGGGAGAACCCAACGTCACTGTTTGGGAAGATGATGGCCGAGACGCGAGGTATGACGAACGCGCCCGGT
GCCGCACAGATGTTTGGAAACGCAGGTAGGGAATATAAGGAGAAGTACGGTGCTAAGAACGAGGACTTCGCCGAG
ATCGCCCGCATCAACCACGAGCACTCCAAGCGGAACCCCTACTCGCAATTCCAGACCGAATATACCCTCGAGCAG
ATCATAAACGCGCCCATGATCTACGAGCCTCTGACCAAGCTACAGTGCTGCCCAACCTCGGATGGCGGTGCCGCC
GCCGTTATTGTCTCGCAGGAGTTCCTCGATGCGCGTCCCCACCTGAAAGAACATGCCATTCTCATCGCCGGTCAG
TGTCTAGCCACCGATGACGACACAGTCTACAGCAAGAGCTCCATTGACCTGATGGGCTTCGGCATGACGCGTCGG
GCGTGCCGCACTGCCGTAGCCGAGGCCGGCGTGAATGTCAAGGATATCAAGGTTTGCGAGCTGCATGATTGCTTC
TCGGCCAATGAGATGATTACTATTGATGCGCTGGAGCTGAGTGAACCCGGCCAGGCCCATGAGATGGTCCGCCGT
GGCGATATCACGTACGGCGGAAAGATGGTCATCAACCCATCTGGCGGTCTCATCTCCAAGGGTCACCCGCTTGGT
GCTACGGGTATTGCGCAGTGTGCTGAGCTGGTCTGGCACCTGCGTGGCTGGGCCAACAATCGCCTGGTTGACGGT
ACTTCCGCGGCACTGCAGCACAACCTCGGTCTGGGCGGTGCCGTTGTCGTCACCGTCTACAAGCGTACTGATGGC
AAGGCCGCCACGGCTGTGACATCAGACGTCGTTGGCAAAATCAACGGTTTGGGCTATAACCCAGCTGTGGAGGCT
AAGGGCTTCACTGCCGAGCAGGCCAAGTCCGTCGTGAGCAAGACGCACAGCTCTCAGTATGCCCTGTCAGATACC
CAAGAGCGGGTCCTTGCCAGGTTCTAG
Gene >Pro_DTO377G3_2|g1509.t1
ATGGGCAAGAAGCAAGGAACCCCCGCTTATGTACTGGGCGTTGGCATGACCAAGTTCATCAAGCCACGCGGTAAG
GTCGACTACCATGAGCTCGGCTATGAGGCTGGTATTAAAGCCATGCTCGACGCCAAGATCAACTATGACGATGTT
GACCAGGGCATTGCATGCTACGTCTACGGCGACAGCACCTGCGGCCAGCGCGTCTTCTACCAGTTCGGCCAGACC
AGCATCCCTATCTACAACGTCAACAACAACTGTTCGACCGGCTCGACTGGCCTCGCCATGGCCCGCAATATGGTT
TCCCATGGTGTTGCGGACTGTGTGCTGGTCGTCGGCTTCGAGAAGATGAACCCCGGTAGCTTGCAATCCATGTAC
AACGATCGGGAGAACCCAACGTCACTGTTTGGGAAGATGATGGCCGAGACGCGAGGTATGACGAACGCGCCCGGT
GCCGCACAGATGTTTGGAAACGCAGGTAGGGAATATAAGGAGAAGTACACAACCTCTGGAGTAACAAGAAAGGAT
ATCATGCTAACATGCGAAAAACAGGTACGGTGCTAAGAACGAGGACTTCGCCGAGATCGCCCGCATCAACCACGA
GCACTCCAAGCGGAACCCCTACTCGCAATTCCAGACCGAATATACCCTCGAGCAGATCATAAACGCGCCCATGAT
CTACGAGCCTCTGACCAAGCTACAGTGCTGCCCAACCTCGGATGGCGGTGCCGCCGCCGTTATTGTCTCGCAGGA
GTTCCTCGATGCGCGTCCCCACCTGAAAGAACATGCCATTCTCATCGCCGGTCAGTGTCTAGCCACCGATGACGA
CACAGTCTACAGCAAGAGCTCCATTGACCTGATGGGCTTCGGCATGACGCGTCGGGCGTGCCGCACTGCCGTAGC
CGAGGCCGGCGTGAATGTCAAGGATATCAAGGTTTGCGAGCTGCATGATTGCTTCTCGGCCAATGAGATGATTAC
TATTGATGCGCTGGAGCTGAGTGAACCCGGCCAGGCCCATGAGATGGTCCGCCGTGGCGATATCACGTACGGCGG
AAAGATGGTCATCAACCCATCTGGCGGTCTCATCTCCAAGGGTCACCCGCTTGGTGCTACGGGTATTGCGCAGTG
TGCTGAGCTGGTCTGGCACCTGCGTGGCTGGGCCAACAATCGCCTGGTTGACGGTACTTCCGCGGCACTGCAGCA
CAACCTCGGTCTGGGCGGTGCCGTTGTCGTCACCGTCTACAAGCGTACTGATGGCAAGGCCGCCACGGCTGTGAC
ATCAGACGTCGTTGGCAAAATCAACGGTTTGGGCTATAACCCAGCTGTGGAGGCTAAGGGCTTCACTGCCGAGCA
GGCCAAGTCCGTCGTGAGCAAGACGCACAGCTCTCAGTATGCCCTGTCAGATACCCAAGAGCGGGTCCTTGCCAG
GTTCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail