Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g1502.t1
Gene name
Locationscaffold_02:149492..151273
Strand-
Gene length (bp)1781
Transcript length (bp)1668
Coding sequence length (bp)1668
Protein length (aa) 556

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00324 AA_permease Amino acid permease 3.2E-109 58 518
PF13520 AA_permease_2 Amino acid permease 7.9E-28 62 477

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0016020 membrane Yes
GO:0008150 biological_process No
GO:0051234 establishment of localization No
GO:0006810 transport No
GO:0005575 cellular_component No
GO:0051179 localization No
GO:0005215 transporter activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 48 0.45

Transmembrane Domains

Domain # Start End Length
1 58 77 19
2 84 106 22
3 139 161 22
4 166 188 22
5 193 215 22
6 289 311 22
7 326 348 22
8 385 407 22
9 420 442 22
10 462 484 22
11 494 513 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g1502.t1
MSTIKTFHNDHSTDAVDEFDKDVKTMIHDPESPVQPEDEYVGDFEEISALKQGLHQRHIQMIALAGTIGTGLFLS
SGRAISRSGPLGAFLGYLVMGCAAGTVTLATGEMGTLVPLNGGIVRYAEYFVDPALSFANGYNVVYSYLVSIPAE
IVAAAVLVQFWSDLNSAIWISIFGVVMLCTSMAFVRVYGELEFGFSLMKILLIIGVNLMALVITCGGGPDHKTIG
FEYWRHPGPFVQYLGIGGSLGRFLGVWTSMNSALYAYSGIETITVAAGETKSPRHAIPQAAKRIFFRILIFYVIS
IFMVGLVVPSNEPRLSSSSGTASESPFVIAATLAGIKVVPSIINAVIITSAWSSGNSNMLGGSRVLYGLAVNGKA
PKFFTRLNRFSVPWVAISLYGLFMCLAYMSLSSTANTVFDWLQDLVSITTLTNWLTILVTYLRFYYGCKKQGISR
KSLPWATPLQPYISWASLIMLSLLLITGGYSTFIKGQWSDEGFVSSYINIPLFFIFYFAYKLIHKTKIIPLEDIP
IQPFIDIANRNPEPLPQPKKGLRKLNILWD*
Coding >Pro_DTO377G3_2|g1502.t1
ATGTCCACAATCAAGACCTTTCACAACGATCATTCCACCGACGCTGTCGATGAATTCGACAAAGACGTCAAGACC
ATGATACACGACCCAGAGTCGCCTGTTCAACCAGAAGATGAATATGTCGGAGACTTCGAAGAGATTTCGGCCTTG
AAGCAAGGCCTTCATCAGAGACACATCCAAATGATTGCTTTGGCCGGTACCATTGGAACAGGTCTCTTCCTCAGT
TCTGGTCGAGCAATCTCACGTTCTGGTCCCCTGGGTGCCTTTCTAGGATACTTGGTCATGGGCTGTGCTGCTGGA
ACTGTAACCCTTGCGACGGGCGAGATGGGCACACTTGTTCCTTTGAACGGTGGAATAGTCCGCTACGCCGAATAC
TTTGTTGACCCGGCATTATCGTTTGCCAACGGCTACAACGTGGTATATTCCTACCTTGTGTCTATCCCTGCAGAG
ATTGTGGCCGCTGCTGTGCTCGTGCAGTTCTGGTCTGACCTCAATAGCGCGATTTGGATCAGTATCTTTGGAGTG
GTCATGCTGTGTACCTCTATGGCCTTTGTGAGAGTATACGGGGAGCTCGAGTTCGGTTTCTCCTTGATGAAGATC
TTGCTGATCATTGGAGTCAATCTAATGGCTCTTGTTATTACCTGTGGTGGCGGTCCTGACCATAAAACCATCGGG
TTTGAATACTGGCGCCACCCTGGGCCTTTCGTTCAGTACCTTGGCATCGGTGGCTCTCTTGGTCGCTTTCTCGGT
GTTTGGACATCTATGAATAGTGCTCTTTATGCCTATTCGGGGATTGAAACAATTACCGTTGCCGCTGGAGAGACA
AAATCGCCGAGGCATGCTATCCCGCAGGCGGCTAAGCGGATTTTCTTTCGTATATTGATTTTCTATGTCATCTCA
ATCTTCATGGTCGGCCTTGTGGTCCCCTCCAATGAACCTAGACTCAGCAGTTCTAGTGGCACAGCTTCCGAGTCT
CCCTTTGTGATCGCAGCTACCCTAGCCGGAATCAAGGTGGTGCCATCAATCATCAACGCTGTCATCATCACGTCG
GCGTGGTCTTCAGGCAACTCGAACATGCTCGGAGGGTCGAGAGTATTGTACGGGCTGGCGGTAAACGGTAAAGCC
CCCAAGTTCTTCACTCGACTTAACAGATTCTCGGTTCCCTGGGTCGCAATTTCGCTCTACGGTCTGTTCATGTGC
CTGGCATACATGTCGCTCTCCTCAACTGCCAACACCGTGTTTGATTGGCTGCAAGACCTTGTCTCCATCACAACT
CTGACCAACTGGCTCACTATCCTGGTCACGTATCTTCGCTTTTATTACGGCTGCAAGAAACAAGGAATCTCTCGC
AAGTCTCTACCGTGGGCGACGCCGCTCCAGCCATATATCAGTTGGGCCTCGTTGATCATGCTCAGTCTCCTGCTC
ATCACCGGCGGGTACTCGACTTTTATCAAAGGGCAATGGAGCGACGAAGGATTCGTCTCCTCTTATATCAATATT
CCTCTCTTCTTCATCTTTTATTTTGCGTACAAGTTGATTCACAAGACAAAGATCATCCCCCTGGAAGATATACCC
ATTCAACCGTTTATTGATATTGCCAATCGCAACCCAGAGCCGCTGCCACAACCAAAGAAAGGCCTTCGCAAGCTG
AACATTTTATGGGACTGA
Transcript >Pro_DTO377G3_2|g1502.t1
ATGTCCACAATCAAGACCTTTCACAACGATCATTCCACCGACGCTGTCGATGAATTCGACAAAGACGTCAAGACC
ATGATACACGACCCAGAGTCGCCTGTTCAACCAGAAGATGAATATGTCGGAGACTTCGAAGAGATTTCGGCCTTG
AAGCAAGGCCTTCATCAGAGACACATCCAAATGATTGCTTTGGCCGGTACCATTGGAACAGGTCTCTTCCTCAGT
TCTGGTCGAGCAATCTCACGTTCTGGTCCCCTGGGTGCCTTTCTAGGATACTTGGTCATGGGCTGTGCTGCTGGA
ACTGTAACCCTTGCGACGGGCGAGATGGGCACACTTGTTCCTTTGAACGGTGGAATAGTCCGCTACGCCGAATAC
TTTGTTGACCCGGCATTATCGTTTGCCAACGGCTACAACGTGGTATATTCCTACCTTGTGTCTATCCCTGCAGAG
ATTGTGGCCGCTGCTGTGCTCGTGCAGTTCTGGTCTGACCTCAATAGCGCGATTTGGATCAGTATCTTTGGAGTG
GTCATGCTGTGTACCTCTATGGCCTTTGTGAGAGTATACGGGGAGCTCGAGTTCGGTTTCTCCTTGATGAAGATC
TTGCTGATCATTGGAGTCAATCTAATGGCTCTTGTTATTACCTGTGGTGGCGGTCCTGACCATAAAACCATCGGG
TTTGAATACTGGCGCCACCCTGGGCCTTTCGTTCAGTACCTTGGCATCGGTGGCTCTCTTGGTCGCTTTCTCGGT
GTTTGGACATCTATGAATAGTGCTCTTTATGCCTATTCGGGGATTGAAACAATTACCGTTGCCGCTGGAGAGACA
AAATCGCCGAGGCATGCTATCCCGCAGGCGGCTAAGCGGATTTTCTTTCGTATATTGATTTTCTATGTCATCTCA
ATCTTCATGGTCGGCCTTGTGGTCCCCTCCAATGAACCTAGACTCAGCAGTTCTAGTGGCACAGCTTCCGAGTCT
CCCTTTGTGATCGCAGCTACCCTAGCCGGAATCAAGGTGGTGCCATCAATCATCAACGCTGTCATCATCACGTCG
GCGTGGTCTTCAGGCAACTCGAACATGCTCGGAGGGTCGAGAGTATTGTACGGGCTGGCGGTAAACGGTAAAGCC
CCCAAGTTCTTCACTCGACTTAACAGATTCTCGGTTCCCTGGGTCGCAATTTCGCTCTACGGTCTGTTCATGTGC
CTGGCATACATGTCGCTCTCCTCAACTGCCAACACCGTGTTTGATTGGCTGCAAGACCTTGTCTCCATCACAACT
CTGACCAACTGGCTCACTATCCTGGTCACGTATCTTCGCTTTTATTACGGCTGCAAGAAACAAGGAATCTCTCGC
AAGTCTCTACCGTGGGCGACGCCGCTCCAGCCATATATCAGTTGGGCCTCGTTGATCATGCTCAGTCTCCTGCTC
ATCACCGGCGGGTACTCGACTTTTATCAAAGGGCAATGGAGCGACGAAGGATTCGTCTCCTCTTATATCAATATT
CCTCTCTTCTTCATCTTTTATTTTGCGTACAAGTTGATTCACAAGACAAAGATCATCCCCCTGGAAGATATACCC
ATTCAACCGTTTATTGATATTGCCAATCGCAACCCAGAGCCGCTGCCACAACCAAAGAAAGGCCTTCGCAAGCTG
AACATTTTATGGGACTGA
Gene >Pro_DTO377G3_2|g1502.t1
ATGTCCACAATCAAGACCTTTCACAACGATCATTCCACCGACGCTGTCGATGAATTCGACAAAGACGTCAAGACC
ATGATACACGACCCAGAGTCGCCTGTTCAACCAGAAGATGAATATGTCGGAGACTTCGAAGAGATTTCGGCCTTG
AAGCAAGGCCTTCATCAGAGACACATCCAAATGATTGCTTTGGCCGGTACCATTGGAACAGGTCTCTTCCTCAGT
TCTGGTCGAGCAATCTCACGTTCTGGTCCCCTGGGTGCCTTTCTAGGATACTTGGTCATGGGCTGTGCTGCTGGA
ACTGTAACCCTTGCGACGGGCGAGATGGGCACACTTGTTCCTTTGAACGGTGGAATAGTCCGCTACGCCGAATAC
TTTGTTGACCCGGCATTATCGTTTGCCAACGGCTACAACGTGGTATATTCCTACCTTGTGTCTATCCCTGCAGAG
ATTGTGGCCGCTGCTGTGCTCGTGCAGTTCTGGTCTGACCTCAATAGCGCGATTTGGATCAGTATCTTTGGAGTG
GTCATGCTGTGTACCTCTATGGCCTTTGTGAGAGTATACGGGGAGCTCGAGTTCGGTTTCTCCTTGATGAAGATC
TTGCTGATCATTGGAGTCAATCTAATGGTAAGCTCAAGTTTCTGCCACTGAATTGACCGGCTTTGGTGCTAACAA
GGATTAACCAGGCTCTTGTTATTACCTGTGGTGGCGGTCCTGACCATAAAACCATCGGGTTTGAATACTGGCGCC
ACCCTGGGCCTTTCGTTCAGTACCTTGGCATCGGTGGCTCTCTTGGTCGCTTTCTCGGTGTTTGGACATCTATGA
ATAGTGCTCTTTATGCCTATTCGGGGATTGAAACAATTACCGTTGCCGCTGGAGAGACAAAATCGCCGAGGCATG
CTATCCCGCAGGCGGCTAAGCGGATTTTCTTTCGTATATTGATTTTCTATGGTATGTTGATTCTAAAAGATAGAA
AATCCTTCAAATCTGACGTCTTCCCTTTAGTCATCTCAATCTTCATGGTCGGCCTTGTGGTCCCCTCCAATGAAC
CTAGACTCAGCAGTTCTAGTGGCACAGCTTCCGAGTCTCCCTTTGTGATCGCAGCTACCCTAGCCGGAATCAAGG
TGGTGCCATCAATCATCAACGCTGTCATCATCACGTCGGCGTGGTCTTCAGGCAACTCGAACATGCTCGGAGGGT
CGAGAGTATTGTACGGGCTGGCGGTAAACGGTAAAGCCCCCAAGTTCTTCACTCGACTTAACAGATTCTCGGTTC
CCTGGGTCGCAATTTCGCTCTACGGTCTGTTCATGTGCCTGGCATACATGTCGCTCTCCTCAACTGCCAACACCG
TGTTTGATTGGCTGCAAGACCTTGTCTCCATCACAACTCTGACCAACTGGCTCACTATCCTGGTCACGTATCTTC
GCTTTTATTACGGCTGCAAGAAACAAGGAATCTCTCGCAAGTCTCTACCGTGGGCGACGCCGCTCCAGCCATATA
TCAGTTGGGCCTCGTTGATCATGCTCAGTCTCCTGCTCATCACCGGCGGGTACTCGACTTTTATCAAAGGGCAAT
GGAGCGACGAAGGATTCGTCTCCTCTTATATCAATATTCCTCTCTTCTTCATCTTTTATTTTGCGTACAAGTTGA
TTCACAAGACAAAGATCATCCCCCTGGAAGATATACCCATTCAACCGTTTATTGATATTGCCAATCGCAACCCAG
AGCCGCTGCCACAACCAAAGAAAGGCCTTCGCAAGCTGAACATTTTATGGGACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail