Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g1491.t1
Gene name
Locationscaffold_02:125925..126870
Strand+
Gene length (bp)945
Transcript length (bp)945
Coding sequence length (bp)945
Protein length (aa) 315

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02826 2-Hacid_dh_C D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain 2.6E-44 103 286

GO

GO Term Description Terminal node
GO:0051287 NAD binding Yes
GO:1901265 nucleoside phosphate binding No
GO:0097159 organic cyclic compound binding No
GO:0005488 binding No
GO:0000166 nucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0003674 molecular_function No
GO:0036094 small molecule binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 105.90 63.95 147.85
5d_25C Five days - 25 degrees Celsius 79.92 47.29 112.54
7d_25C Seven days - 25 degrees Celsius 73.35 42.96 103.73
10d_25C Ten days - 25 degrees Celsius 54.11 30.32 77.89
7d_15C Seven days - 15 degrees Celsius 107.19 64.95 149.42
7d_30C Seven days - 30 degrees Celsius 56.02 31.57 80.47

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.226560 no
3d_25C 7d_25C 0.098462 no
3d_25C 7d_15C 0.973693 no
3d_25C 7d_30C 0.002761 yes
3d_25C 10d_25C 0.001278 yes
5d_25C 7d_25C 0.783864 no
5d_25C 7d_15C 0.211835 no
5d_25C 7d_30C 0.137648 no
5d_25C 10d_25C 0.092792 no
7d_25C 7d_15C 0.082307 no
7d_25C 7d_30C 0.286389 no
7d_25C 10d_25C 0.213590 no
7d_15C 7d_30C 0.002761 yes
7d_15C 10d_25C 0.002297 yes
7d_30C 10d_25C 0.927142 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g1491.t1
MKLLYPTSLYIDAKSLEGFSVELHPYDVTVPIPESLIDAEFLVTWANKATNLRDAASRMKNLRWIQSLAAGPNDV
LGAGFDASRIAITTGSGLHDETVAEHTLGLLLNAVRRFYEMRDYQNRGEWPAHLGGPQPDRAPGTFRTLKGANIT
IWGFGNIAKSLSPVLTALGANVTGVARSTGVRNGFEVVAEDRLQEILPKTDALVMILPGSASTNGALNAERLALL
PSHAWVVNVGRGTSVDEDALLAALEKGSIGGAALDVFSVEPLPKESKLYAAPNLILSPHAAGGRPRGAEALIAFN
LRRQLAGQELKNII*
Coding >Pro_DTO377G3_2|g1491.t1
ATGAAACTCCTCTACCCAACCTCCCTCTACATTGACGCGAAGTCCCTAGAAGGCTTCTCCGTCGAATTGCATCCC
TACGACGTCACAGTCCCAATTCCCGAATCCCTAATCGACGCCGAGTTCCTAGTAACATGGGCCAACAAAGCCACG
AACCTCCGCGACGCAGCCTCCCGCATGAAGAACCTCCGCTGGATCCAGTCGCTAGCAGCCGGACCAAACGACGTC
CTCGGTGCGGGCTTCGACGCCTCCCGAATCGCTATCACAACCGGCTCCGGCCTGCATGACGAGACAGTCGCCGAA
CACACCCTCGGCCTGCTACTTAATGCTGTCCGCCGCTTCTATGAAATGCGCGACTACCAGAACCGCGGCGAGTGG
CCCGCCCACCTGGGCGGCCCCCAGCCCGATCGCGCCCCCGGCACGTTCCGCACCCTCAAGGGTGCTAATATTACC
ATCTGGGGATTCGGAAATATCGCCAAGTCTCTCTCGCCCGTGCTGACCGCGCTCGGGGCTAATGTCACCGGTGTT
GCGCGGAGTACTGGTGTGCGGAATGGGTTCGAGGTTGTTGCGGAGGATCGCTTGCAGGAGATTCTCCCCAAGACT
GATGCGCTTGTTATGATTCTGCCTGGATCGGCGAGTACCAATGGTGCGCTTAATGCTGAGCGCTTGGCTTTGCTG
CCGAGTCATGCTTGGGTTGTTAATGTTGGCCGGGGAACTTCCGTTGATGAGGATGCGCTGCTTGCGGCGCTTGAA
AAGGGCAGCATTGGCGGCGCGGCGCTGGATGTTTTCTCCGTTGAGCCGCTCCCGAAGGAGTCTAAGCTTTATGCC
GCGCCTAATCTTATTCTTTCGCCTCATGCTGCCGGTGGACGTCCGCGTGGGGCTGAGGCGCTTATTGCGTTTAAC
CTGAGACGGCAGCTTGCTGGGCAGGAGCTGAAGAATATTATTTGA
Transcript >Pro_DTO377G3_2|g1491.t1
ATGAAACTCCTCTACCCAACCTCCCTCTACATTGACGCGAAGTCCCTAGAAGGCTTCTCCGTCGAATTGCATCCC
TACGACGTCACAGTCCCAATTCCCGAATCCCTAATCGACGCCGAGTTCCTAGTAACATGGGCCAACAAAGCCACG
AACCTCCGCGACGCAGCCTCCCGCATGAAGAACCTCCGCTGGATCCAGTCGCTAGCAGCCGGACCAAACGACGTC
CTCGGTGCGGGCTTCGACGCCTCCCGAATCGCTATCACAACCGGCTCCGGCCTGCATGACGAGACAGTCGCCGAA
CACACCCTCGGCCTGCTACTTAATGCTGTCCGCCGCTTCTATGAAATGCGCGACTACCAGAACCGCGGCGAGTGG
CCCGCCCACCTGGGCGGCCCCCAGCCCGATCGCGCCCCCGGCACGTTCCGCACCCTCAAGGGTGCTAATATTACC
ATCTGGGGATTCGGAAATATCGCCAAGTCTCTCTCGCCCGTGCTGACCGCGCTCGGGGCTAATGTCACCGGTGTT
GCGCGGAGTACTGGTGTGCGGAATGGGTTCGAGGTTGTTGCGGAGGATCGCTTGCAGGAGATTCTCCCCAAGACT
GATGCGCTTGTTATGATTCTGCCTGGATCGGCGAGTACCAATGGTGCGCTTAATGCTGAGCGCTTGGCTTTGCTG
CCGAGTCATGCTTGGGTTGTTAATGTTGGCCGGGGAACTTCCGTTGATGAGGATGCGCTGCTTGCGGCGCTTGAA
AAGGGCAGCATTGGCGGCGCGGCGCTGGATGTTTTCTCCGTTGAGCCGCTCCCGAAGGAGTCTAAGCTTTATGCC
GCGCCTAATCTTATTCTTTCGCCTCATGCTGCCGGTGGACGTCCGCGTGGGGCTGAGGCGCTTATTGCGTTTAAC
CTGAGACGGCAGCTTGCTGGGCAGGAGCTGAAGAATATTATTTGA
Gene >Pro_DTO377G3_2|g1491.t1
ATGAAACTCCTCTACCCAACCTCCCTCTACATTGACGCGAAGTCCCTAGAAGGCTTCTCCGTCGAATTGCATCCC
TACGACGTCACAGTCCCAATTCCCGAATCCCTAATCGACGCCGAGTTCCTAGTAACATGGGCCAACAAAGCCACG
AACCTCCGCGACGCAGCCTCCCGCATGAAGAACCTCCGCTGGATCCAGTCGCTAGCAGCCGGACCAAACGACGTC
CTCGGTGCGGGCTTCGACGCCTCCCGAATCGCTATCACAACCGGCTCCGGCCTGCATGACGAGACAGTCGCCGAA
CACACCCTCGGCCTGCTACTTAATGCTGTCCGCCGCTTCTATGAAATGCGCGACTACCAGAACCGCGGCGAGTGG
CCCGCCCACCTGGGCGGCCCCCAGCCCGATCGCGCCCCCGGCACGTTCCGCACCCTCAAGGGTGCTAATATTACC
ATCTGGGGATTCGGAAATATCGCCAAGTCTCTCTCGCCCGTGCTGACCGCGCTCGGGGCTAATGTCACCGGTGTT
GCGCGGAGTACTGGTGTGCGGAATGGGTTCGAGGTTGTTGCGGAGGATCGCTTGCAGGAGATTCTCCCCAAGACT
GATGCGCTTGTTATGATTCTGCCTGGATCGGCGAGTACCAATGGTGCGCTTAATGCTGAGCGCTTGGCTTTGCTG
CCGAGTCATGCTTGGGTTGTTAATGTTGGCCGGGGAACTTCCGTTGATGAGGATGCGCTGCTTGCGGCGCTTGAA
AAGGGCAGCATTGGCGGCGCGGCGCTGGATGTTTTCTCCGTTGAGCCGCTCCCGAAGGAGTCTAAGCTTTATGCC
GCGCCTAATCTTATTCTTTCGCCTCATGCTGCCGGTGGACGTCCGCGTGGGGCTGAGGCGCTTATTGCGTTTAAC
CTGAGACGGCAGCTTGCTGGGCAGGAGCTGAAGAATATTATTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail