Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g148.t1
Gene name
Locationscaffold_01:373807..378691
Strand+
Gene length (bp)4884
Transcript length (bp)4779
Coding sequence length (bp)4779
Protein length (aa) 1593

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00621 RhoGEF RhoGEF domain 3.3E-21 251 458
PF12015 Bud3_N Bud3, N-terminal 4.6E-06 46 148

GO

GO Term Description Terminal node
GO:0005085 guanyl-nucleotide exchange factor activity Yes
GO:0030234 enzyme regulator activity No
GO:0060589 nucleoside-triphosphatase regulator activity No
GO:0098772 molecular function regulator activity No
GO:0030695 GTPase regulator activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 3.92 1.83 6.02
5d_25C Five days - 25 degrees Celsius 2.64 1.06 4.22
7d_25C Seven days - 25 degrees Celsius 3.22 1.34 5.09
10d_25C Ten days - 25 degrees Celsius 1.91 0.70 3.13
7d_15C Seven days - 15 degrees Celsius 1.58 0.30 2.86
7d_30C Seven days - 30 degrees Celsius 5.49 2.73 8.25

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.249045 no
3d_25C 7d_25C 0.608947 no
3d_25C 7d_15C 0.025858 yes
3d_25C 7d_30C 0.279305 no
3d_25C 10d_25C 0.022435 yes
5d_25C 7d_25C 0.635531 no
5d_25C 7d_15C 0.229033 no
5d_25C 7d_30C 0.014676 yes
5d_25C 10d_25C 0.412772 no
7d_25C 7d_15C 0.084097 no
7d_25C 7d_30C 0.070375 no
7d_25C 10d_25C 0.131507 no
7d_15C 7d_30C 0.001804 yes
7d_15C 10d_25C 0.724118 no
7d_30C 10d_25C 0.000700 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g148.t1
MATIAPPSGICTLADLPLEHLSLYHVVDPCLSSIFVFYGAVSTANATVSSSRIQAHIFTPAGFQSYPRITVSPAA
PVYAAVNHLPREKQGDEVCRGLAVSMLRYFAELSEPVKHRLTGVARTGRPGGKVPKMFDEMHAADLANRMTKVDD
SLEIIQDIRSAYQERKVPWVDIDVVLPTGTIQPFQRRESMGSDLEGGQNPQYGPYTPLIEALGDPMFLPTARLKR
APSQPTNVSKSRLFARSQKEALRLTMCELVDTEERYVAKLYSLVHEVADEFRQKAVGRGPSSNSPDEAALAALFP
PCLNEILEVNLGFLDVIRHVLDETEKDAITDIGQDTELPSNRRGLPRDRSDPLGILAFAKALFEWLPQFSQPYGD
YMRAHTGFTQTLNSFMKDKNSSFSKRVYETGEQRLRSLLMEPVQRLPRYSLLIDTMTSNLPLVHPAVRTLLKARD
IVKDICALENNSPSSHTQSLQRLQELVNGWPAKTFPEGRLITAVDFNEITQPYRLDTQSSGRSSTGIMLLYKNCL
VLLEKPAESRTTARGLLADIDNAAASTNDMSMSLPQSELQVVQVLDFHNVRCMQSTCGRILFAVPISAKSSKEET
SSDLLALELAGTYEGRANRLIEEISKAKIEGRFPESEREGGKWTLRSPPTGSASNVGILACVCEDGESAALDQIQ
ASPIRIVFDTSKATCGQMLRGSNLEVIISISPPNGDQYRLDIDSVVGSGSTDLITVDTFISTLSRRLQYLLSPLH
SARNPALTNSLVHSNFEILRYIASSLITQVKSSRGFRPPSPTKLISNLLGGSRDNVPTLKGPGSATLTGEFPKMP
PPRVNLSRSNTLPSAFPGKDKDKDKEKEKEKEETGNRISVVGTSASKGLDTQFGLLEQTFAAYVLSLQSRSGNIL
GRMLRVRDHVDRAPVNELYNILLEDPSRIQAAAEVPVDTLFVAFETFLANAWRTSMGPVLSSSSLKWIQSQFDTM
IPRDFDEQFRKFVTDMSPQNRRALAAIIRLLAELLDASGNDGDRGALTMAFAEVLTEDGDPSHHVSLLDRLVEDF
DNLFEEFIPGGTSVEGTLTCDQSKSHANTGSVGSNSSSFRKRFGFGMSRDTPKNEGESKVAAILRTLSKKQSPAG
SELNTPKGSLMRSKSTDVDSRLGFLRPTSRDRPTSRDRPTSRDRPISRGSPASRDRPLSRDLPYRPYGFASEEQI
SRPGTGYDNPPSLSSFRGFSEDSVRRTRKKRRSSLSDIRPLTSSSDASSISPTQQLRPTTPSSRPQGEVVTPTNQ
SRPQSSYIPTPPMRGQSPMRSRPPAKSGSPTRLGSPIRRLSPPRPSTPSRKENIDPRAPQMERAFKSRGSVSESP
ADESRRRSQTSGIPQRIPGLRERPSSNASDTKRPQSSSGLQKPQKPRMQSPQKLRDRVQLEKRTQNSTQLGLKDE
LTELGNELRSLKLTPPRKPNAMNLEFDFDRTDINPHAATAASLEARMRNLEARFETVTGEYKCRTSALERDLESS
LVLSEKRVKKLDELYREASAENEALYDRFNTELSKIAKDVRLGHAEDALKSQLASALDEIGRVKKENFRLKREVG
GLRAQSAAAALLKASEQ*
Coding >Pro_DTO377G3_2|g148.t1
ATGGCGACTATCGCACCTCCCTCCGGAATCTGTACACTGGCGGACCTTCCTCTCGAACATCTCAGCCTCTATCAC
GTCGTCGACCCATGTTTATCATCCATCTTCGTCTTCTATGGCGCCGTCTCTACCGCCAATGCTACAGTGAGCAGT
TCCCGTATTCAGGCCCATATATTCACACCCGCCGGGTTTCAAAGTTACCCTCGGATTACGGTGTCCCCGGCTGCC
CCCGTGTATGCTGCGGTCAACCACCTACCCCGCGAAAAACAAGGTGATGAGGTGTGTCGTGGACTTGCAGTCAGC
ATGCTGAGATATTTTGCCGAGCTGTCGGAGCCGGTGAAGCACCGTCTGACTGGGGTGGCTCGCACTGGAAGACCG
GGAGGAAAGGTCCCCAAGATGTTTGATGAGATGCATGCTGCAGATCTTGCCAACCGTATGACAAAGGTGGATGAT
TCTTTGGAGATTATTCAGGATATTCGGAGCGCATATCAGGAACGCAAGGTACCATGGGTCGACATTGATGTGGTG
CTTCCTACGGGTACTATACAACCATTCCAACGGCGAGAGAGTATGGGATCAGATCTTGAGGGAGGTCAGAATCCG
CAGTATGGTCCATACACACCCCTGATAGAGGCGTTGGGAGATCCTATGTTTTTGCCAACAGCTCGATTGAAGCGT
GCGCCGTCCCAGCCGACCAATGTCAGCAAATCACGGCTGTTCGCAAGAAGCCAGAAAGAAGCTCTTCGTCTTACC
ATGTGTGAGCTTGTGGATACCGAAGAGAGATATGTCGCCAAACTTTATTCTCTTGTGCATGAAGTGGCCGACGAG
TTTCGGCAAAAGGCCGTGGGCAGAGGACCATCCAGCAACAGCCCCGACGAGGCAGCTTTGGCGGCATTATTCCCA
CCATGTTTGAATGAAATTCTGGAAGTCAACCTGGGCTTTCTCGATGTCATTCGTCATGTGCTTGATGAAACAGAG
AAAGATGCCATCACAGATATTGGTCAGGACACGGAGCTGCCTTCTAATCGTCGGGGTTTGCCAAGAGATAGATCG
GATCCGCTTGGAATTCTGGCATTCGCAAAGGCCCTCTTTGAATGGCTACCACAATTTTCACAGCCATATGGAGAC
TACATGCGAGCACATACAGGCTTCACGCAAACTCTGAATTCGTTCATGAAAGATAAGAATTCTAGCTTTTCCAAG
AGAGTATACGAAACGGGAGAGCAGAGACTGCGCTCTCTGTTGATGGAACCCGTCCAGCGACTACCTCGATACAGT
CTGCTGATTGACACCATGACTAGCAATCTGCCCTTGGTCCATCCTGCCGTGCGAACTCTGCTAAAAGCACGAGAC
ATTGTGAAGGATATATGTGCGCTAGAGAATAATTCCCCATCGAGCCACACCCAAAGCCTTCAACGCCTCCAAGAG
CTAGTCAACGGATGGCCAGCGAAAACATTCCCTGAAGGTCGGCTGATTACTGCAGTCGATTTCAACGAAATTACC
CAGCCGTACCGTCTAGACACACAGTCATCTGGCAGAAGCAGCACAGGGATCATGCTTCTTTATAAGAACTGCCTA
GTCCTTCTAGAGAAACCCGCCGAAAGCCGGACTACGGCACGTGGTCTGCTGGCTGATATCGACAATGCGGCCGCT
TCAACCAATGACATGTCCATGTCTTTGCCACAATCCGAACTCCAGGTTGTGCAGGTGCTAGACTTTCATAACGTG
CGTTGTATGCAATCCACGTGTGGTCGAATTTTGTTCGCCGTGCCAATTTCAGCCAAGTCCTCAAAAGAAGAGACA
AGCTCTGACCTGCTTGCATTGGAACTGGCTGGAACGTATGAAGGAAGAGCCAATCGACTGATCGAAGAAATATCC
AAGGCGAAGATTGAGGGTCGATTCCCCGAGAGTGAAAGAGAAGGAGGTAAATGGACGCTAAGAAGCCCTCCCACC
GGGTCTGCGAGTAACGTGGGAATACTCGCCTGTGTGTGCGAGGACGGTGAAAGTGCCGCGCTCGACCAGATTCAG
GCATCCCCAATACGCATTGTTTTTGATACATCCAAGGCGACCTGCGGTCAAATGTTGAGAGGTTCCAACCTTGAG
GTCATCATATCAATATCTCCTCCAAATGGAGATCAATACAGACTAGATATCGATTCTGTGGTTGGATCTGGGTCT
ACAGATTTGATCACGGTGGACACATTTATTTCCACTCTTTCGCGACGTCTTCAATATTTGCTCTCGCCTCTGCAT
AGCGCCCGAAACCCAGCATTGACGAACTCATTGGTTCATTCTAATTTTGAAATTCTTCGGTACATCGCGAGCAGC
TTAATCACGCAGGTCAAGTCTTCACGGGGCTTCCGGCCACCTTCGCCGACCAAACTAATCTCAAACCTGTTGGGG
GGTAGCCGTGATAATGTGCCCACTCTCAAGGGGCCAGGGTCGGCCACTCTTACCGGCGAATTCCCAAAAATGCCT
CCGCCAAGAGTGAATCTGTCGAGATCGAACACTCTACCTTCGGCATTCCCAGGAAAAGACAAGGACAAGGACAAG
GAAAAGGAGAAAGAGAAAGAGGAAACCGGGAACAGGATATCTGTCGTTGGGACATCTGCCTCCAAGGGATTGGAT
ACTCAGTTCGGGTTGCTGGAGCAGACATTTGCAGCCTATGTGCTTTCTCTGCAGTCTCGGAGTGGAAACATTCTG
GGTCGAATGCTTCGGGTCAGAGATCACGTTGACCGGGCGCCGGTCAATGAGCTCTACAATATTTTGCTAGAAGAC
CCGAGCAGAATTCAGGCTGCCGCCGAAGTGCCAGTTGATACGCTTTTTGTCGCTTTCGAAACCTTTTTGGCGAAT
GCTTGGAGAACAAGTATGGGCCCCGTCTTGAGCTCCTCTTCTCTGAAATGGATTCAGAGCCAGTTTGACACCATG
ATACCGCGGGATTTTGATGAGCAATTTCGGAAATTTGTGACAGACATGAGCCCGCAAAATAGACGAGCTCTAGCT
GCGATTATTCGACTACTTGCCGAGCTACTCGATGCATCTGGAAATGACGGAGATCGCGGTGCTTTGACGATGGCA
TTTGCGGAGGTACTCACCGAAGACGGAGATCCTAGCCATCATGTCTCCCTTTTGGACCGACTGGTCGAAGACTTT
GACAACCTCTTTGAAGAATTTATTCCTGGGGGTACCTCAGTGGAAGGAACACTGACCTGCGATCAATCGAAATCA
CATGCCAATACCGGGTCAGTCGGTTCCAATTCTTCCTCTTTCCGGAAACGCTTCGGCTTCGGTATGTCTAGAGAT
ACTCCGAAAAATGAAGGCGAAAGCAAAGTCGCAGCAATTCTACGGACATTAAGCAAGAAGCAAAGCCCAGCCGGC
TCGGAGCTCAATACGCCCAAGGGTTCTTTGATGCGCTCAAAGTCGACTGATGTGGACTCTCGTCTGGGCTTCCTT
CGCCCTACATCGCGCGATCGTCCTACATCCCGTGATCGCCCTACATCTCGTGATCGCCCTATCTCTCGCGGTAGC
CCTGCTTCTCGCGATCGGCCTTTATCCCGTGACCTTCCGTATCGTCCGTACGGGTTTGCATCTGAGGAGCAAATC
TCGAGGCCAGGCACTGGGTACGACAACCCACCCTCTCTATCTTCTTTCCGAGGATTCTCTGAGGATAGCGTGCGA
AGAACTCGCAAAAAAAGAAGGAGCTCCCTTTCGGATATACGACCACTCACATCATCCTCAGATGCATCCAGTATC
TCTCCAACTCAACAGCTCCGCCCGACGACCCCTTCCAGTCGCCCTCAAGGAGAAGTGGTAACGCCCACCAACCAG
TCCAGGCCTCAGAGCAGTTACATACCAACACCACCTATGCGTGGTCAGTCACCAATGCGTTCTAGGCCGCCAGCA
AAATCCGGGTCACCGACGCGACTAGGATCACCCATTCGCCGTCTGTCTCCGCCCCGCCCTTCGACGCCGAGCAGG
AAGGAGAACATTGATCCCAGGGCTCCACAGATGGAGCGTGCATTTAAGTCCAGGGGCAGTGTATCAGAATCGCCA
GCCGATGAGTCAAGGAGGAGATCCCAAACGTCAGGCATCCCCCAGCGGATTCCGGGCCTTCGGGAGCGGCCAAGC
AGCAACGCTTCCGATACCAAGCGACCACAATCCTCGTCTGGCTTGCAAAAACCACAGAAACCGCGGATGCAAAGC
CCACAAAAGTTACGCGATCGTGTTCAACTAGAAAAGAGAACCCAAAACTCTACCCAATTGGGCCTGAAGGACGAG
CTCACGGAGCTTGGTAACGAATTACGTTCTCTGAAGCTCACACCACCAAGGAAACCCAACGCAATGAACTTGGAG
TTTGATTTTGACCGTACAGACATCAATCCACATGCTGCTACCGCCGCGTCCCTTGAAGCTCGCATGCGCAATCTT
GAAGCCCGATTTGAGACAGTTACTGGGGAATACAAGTGCCGCACATCCGCTCTCGAGCGAGACCTGGAGTCGTCC
TTGGTTCTTAGCGAGAAGCGTGTTAAGAAATTGGACGAGCTTTATCGTGAGGCAAGCGCCGAGAACGAGGCTCTC
TATGATCGGTTTAATACCGAGCTCAGCAAGATTGCGAAGGATGTCCGATTGGGCCACGCAGAAGACGCGTTGAAG
TCTCAACTGGCAAGTGCCCTAGACGAGATCGGCCGAGTGAAGAAAGAAAACTTCCGCTTGAAACGAGAAGTCGGA
GGTCTTCGAGCCCAGTCAGCTGCCGCTGCACTGCTGAAGGCGAGCGAGCAATGA
Transcript >Pro_DTO377G3_2|g148.t1
ATGGCGACTATCGCACCTCCCTCCGGAATCTGTACACTGGCGGACCTTCCTCTCGAACATCTCAGCCTCTATCAC
GTCGTCGACCCATGTTTATCATCCATCTTCGTCTTCTATGGCGCCGTCTCTACCGCCAATGCTACAGTGAGCAGT
TCCCGTATTCAGGCCCATATATTCACACCCGCCGGGTTTCAAAGTTACCCTCGGATTACGGTGTCCCCGGCTGCC
CCCGTGTATGCTGCGGTCAACCACCTACCCCGCGAAAAACAAGGTGATGAGGTGTGTCGTGGACTTGCAGTCAGC
ATGCTGAGATATTTTGCCGAGCTGTCGGAGCCGGTGAAGCACCGTCTGACTGGGGTGGCTCGCACTGGAAGACCG
GGAGGAAAGGTCCCCAAGATGTTTGATGAGATGCATGCTGCAGATCTTGCCAACCGTATGACAAAGGTGGATGAT
TCTTTGGAGATTATTCAGGATATTCGGAGCGCATATCAGGAACGCAAGGTACCATGGGTCGACATTGATGTGGTG
CTTCCTACGGGTACTATACAACCATTCCAACGGCGAGAGAGTATGGGATCAGATCTTGAGGGAGGTCAGAATCCG
CAGTATGGTCCATACACACCCCTGATAGAGGCGTTGGGAGATCCTATGTTTTTGCCAACAGCTCGATTGAAGCGT
GCGCCGTCCCAGCCGACCAATGTCAGCAAATCACGGCTGTTCGCAAGAAGCCAGAAAGAAGCTCTTCGTCTTACC
ATGTGTGAGCTTGTGGATACCGAAGAGAGATATGTCGCCAAACTTTATTCTCTTGTGCATGAAGTGGCCGACGAG
TTTCGGCAAAAGGCCGTGGGCAGAGGACCATCCAGCAACAGCCCCGACGAGGCAGCTTTGGCGGCATTATTCCCA
CCATGTTTGAATGAAATTCTGGAAGTCAACCTGGGCTTTCTCGATGTCATTCGTCATGTGCTTGATGAAACAGAG
AAAGATGCCATCACAGATATTGGTCAGGACACGGAGCTGCCTTCTAATCGTCGGGGTTTGCCAAGAGATAGATCG
GATCCGCTTGGAATTCTGGCATTCGCAAAGGCCCTCTTTGAATGGCTACCACAATTTTCACAGCCATATGGAGAC
TACATGCGAGCACATACAGGCTTCACGCAAACTCTGAATTCGTTCATGAAAGATAAGAATTCTAGCTTTTCCAAG
AGAGTATACGAAACGGGAGAGCAGAGACTGCGCTCTCTGTTGATGGAACCCGTCCAGCGACTACCTCGATACAGT
CTGCTGATTGACACCATGACTAGCAATCTGCCCTTGGTCCATCCTGCCGTGCGAACTCTGCTAAAAGCACGAGAC
ATTGTGAAGGATATATGTGCGCTAGAGAATAATTCCCCATCGAGCCACACCCAAAGCCTTCAACGCCTCCAAGAG
CTAGTCAACGGATGGCCAGCGAAAACATTCCCTGAAGGTCGGCTGATTACTGCAGTCGATTTCAACGAAATTACC
CAGCCGTACCGTCTAGACACACAGTCATCTGGCAGAAGCAGCACAGGGATCATGCTTCTTTATAAGAACTGCCTA
GTCCTTCTAGAGAAACCCGCCGAAAGCCGGACTACGGCACGTGGTCTGCTGGCTGATATCGACAATGCGGCCGCT
TCAACCAATGACATGTCCATGTCTTTGCCACAATCCGAACTCCAGGTTGTGCAGGTGCTAGACTTTCATAACGTG
CGTTGTATGCAATCCACGTGTGGTCGAATTTTGTTCGCCGTGCCAATTTCAGCCAAGTCCTCAAAAGAAGAGACA
AGCTCTGACCTGCTTGCATTGGAACTGGCTGGAACGTATGAAGGAAGAGCCAATCGACTGATCGAAGAAATATCC
AAGGCGAAGATTGAGGGTCGATTCCCCGAGAGTGAAAGAGAAGGAGGTAAATGGACGCTAAGAAGCCCTCCCACC
GGGTCTGCGAGTAACGTGGGAATACTCGCCTGTGTGTGCGAGGACGGTGAAAGTGCCGCGCTCGACCAGATTCAG
GCATCCCCAATACGCATTGTTTTTGATACATCCAAGGCGACCTGCGGTCAAATGTTGAGAGGTTCCAACCTTGAG
GTCATCATATCAATATCTCCTCCAAATGGAGATCAATACAGACTAGATATCGATTCTGTGGTTGGATCTGGGTCT
ACAGATTTGATCACGGTGGACACATTTATTTCCACTCTTTCGCGACGTCTTCAATATTTGCTCTCGCCTCTGCAT
AGCGCCCGAAACCCAGCATTGACGAACTCATTGGTTCATTCTAATTTTGAAATTCTTCGGTACATCGCGAGCAGC
TTAATCACGCAGGTCAAGTCTTCACGGGGCTTCCGGCCACCTTCGCCGACCAAACTAATCTCAAACCTGTTGGGG
GGTAGCCGTGATAATGTGCCCACTCTCAAGGGGCCAGGGTCGGCCACTCTTACCGGCGAATTCCCAAAAATGCCT
CCGCCAAGAGTGAATCTGTCGAGATCGAACACTCTACCTTCGGCATTCCCAGGAAAAGACAAGGACAAGGACAAG
GAAAAGGAGAAAGAGAAAGAGGAAACCGGGAACAGGATATCTGTCGTTGGGACATCTGCCTCCAAGGGATTGGAT
ACTCAGTTCGGGTTGCTGGAGCAGACATTTGCAGCCTATGTGCTTTCTCTGCAGTCTCGGAGTGGAAACATTCTG
GGTCGAATGCTTCGGGTCAGAGATCACGTTGACCGGGCGCCGGTCAATGAGCTCTACAATATTTTGCTAGAAGAC
CCGAGCAGAATTCAGGCTGCCGCCGAAGTGCCAGTTGATACGCTTTTTGTCGCTTTCGAAACCTTTTTGGCGAAT
GCTTGGAGAACAAGTATGGGCCCCGTCTTGAGCTCCTCTTCTCTGAAATGGATTCAGAGCCAGTTTGACACCATG
ATACCGCGGGATTTTGATGAGCAATTTCGGAAATTTGTGACAGACATGAGCCCGCAAAATAGACGAGCTCTAGCT
GCGATTATTCGACTACTTGCCGAGCTACTCGATGCATCTGGAAATGACGGAGATCGCGGTGCTTTGACGATGGCA
TTTGCGGAGGTACTCACCGAAGACGGAGATCCTAGCCATCATGTCTCCCTTTTGGACCGACTGGTCGAAGACTTT
GACAACCTCTTTGAAGAATTTATTCCTGGGGGTACCTCAGTGGAAGGAACACTGACCTGCGATCAATCGAAATCA
CATGCCAATACCGGGTCAGTCGGTTCCAATTCTTCCTCTTTCCGGAAACGCTTCGGCTTCGGTATGTCTAGAGAT
ACTCCGAAAAATGAAGGCGAAAGCAAAGTCGCAGCAATTCTACGGACATTAAGCAAGAAGCAAAGCCCAGCCGGC
TCGGAGCTCAATACGCCCAAGGGTTCTTTGATGCGCTCAAAGTCGACTGATGTGGACTCTCGTCTGGGCTTCCTT
CGCCCTACATCGCGCGATCGTCCTACATCCCGTGATCGCCCTACATCTCGTGATCGCCCTATCTCTCGCGGTAGC
CCTGCTTCTCGCGATCGGCCTTTATCCCGTGACCTTCCGTATCGTCCGTACGGGTTTGCATCTGAGGAGCAAATC
TCGAGGCCAGGCACTGGGTACGACAACCCACCCTCTCTATCTTCTTTCCGAGGATTCTCTGAGGATAGCGTGCGA
AGAACTCGCAAAAAAAGAAGGAGCTCCCTTTCGGATATACGACCACTCACATCATCCTCAGATGCATCCAGTATC
TCTCCAACTCAACAGCTCCGCCCGACGACCCCTTCCAGTCGCCCTCAAGGAGAAGTGGTAACGCCCACCAACCAG
TCCAGGCCTCAGAGCAGTTACATACCAACACCACCTATGCGTGGTCAGTCACCAATGCGTTCTAGGCCGCCAGCA
AAATCCGGGTCACCGACGCGACTAGGATCACCCATTCGCCGTCTGTCTCCGCCCCGCCCTTCGACGCCGAGCAGG
AAGGAGAACATTGATCCCAGGGCTCCACAGATGGAGCGTGCATTTAAGTCCAGGGGCAGTGTATCAGAATCGCCA
GCCGATGAGTCAAGGAGGAGATCCCAAACGTCAGGCATCCCCCAGCGGATTCCGGGCCTTCGGGAGCGGCCAAGC
AGCAACGCTTCCGATACCAAGCGACCACAATCCTCGTCTGGCTTGCAAAAACCACAGAAACCGCGGATGCAAAGC
CCACAAAAGTTACGCGATCGTGTTCAACTAGAAAAGAGAACCCAAAACTCTACCCAATTGGGCCTGAAGGACGAG
CTCACGGAGCTTGGTAACGAATTACGTTCTCTGAAGCTCACACCACCAAGGAAACCCAACGCAATGAACTTGGAG
TTTGATTTTGACCGTACAGACATCAATCCACATGCTGCTACCGCCGCGTCCCTTGAAGCTCGCATGCGCAATCTT
GAAGCCCGATTTGAGACAGTTACTGGGGAATACAAGTGCCGCACATCCGCTCTCGAGCGAGACCTGGAGTCGTCC
TTGGTTCTTAGCGAGAAGCGTGTTAAGAAATTGGACGAGCTTTATCGTGAGGCAAGCGCCGAGAACGAGGCTCTC
TATGATCGGTTTAATACCGAGCTCAGCAAGATTGCGAAGGATGTCCGATTGGGCCACGCAGAAGACGCGTTGAAG
TCTCAACTGGCAAGTGCCCTAGACGAGATCGGCCGAGTGAAGAAAGAAAACTTCCGCTTGAAACGAGAAGTCGGA
GGTCTTCGAGCCCAGTCAGCTGCCGCTGCACTGCTGAAGGCGAGCGAGCAATGA
Gene >Pro_DTO377G3_2|g148.t1
ATGGCGACTATCGCACCTCCCTCCGGAATCTGTACACTGGCGGACCTTCCTCTCGAACATCTCAGCCTCTATCAC
GTCGTCGACCCATGTTTATCATCCATCTTCGTCTTCTATGGCGCCGTCTCTACCGCCAATGCTACAGTGAGCAGT
TCCCGTATTCAGGCCCATATATTCACACCCGCCGGGTTTCAAAGTTACCCTCGGATTACGGTGTCCCCGGCTGCC
CCCGTGTATGCTGCGGTCAACCACCTACCCCGCGAAAAACAAGGTGATGAGGTGTGTCGTGGACTTGCAGTCAGC
ATGCTGAGATATTTTGCCGAGCTGTCGGAGCCGGTGAAGCACCGTCTGACTGGGGTGGCTCGCACTGGAAGACCG
GGAGGAAAGGTCCCCAAGATGTTTGATGAGATGCATGCTGCAGATCTTGCCAACCGTATGACAAAGGTGGATGAT
TCTTTGGAGATTATTCAGGATATTCGGAGCGCATATCAGGAACGCAAGGTACCATGGGTCGACATTGATGTGGTG
CTTCCTACGGGTACTATACAACCATTCCAACGGCGAGAGAGTATGGGATCAGATCTTGAGGGAGGTCAGAATCCG
CAGTATGGTCCATACACACCCCTGATAGAGGCGTTGGGAGATCCTATGTTTTTGCCAACAGCTCGATTGAAGCGT
GCGCCGTCCCAGCCGACCAATGTCAGCAAATCACGGCTGTTCGCAAGAAGCCAGAAAGAAGCTCTTCGTCTTACC
ATGTGTGAGCTTGTGGATACCGAAGAGAGATATGTCGCCAAACTTTATTCTCTTGTGCATGAAGTGGCCGACGAG
TTTCGGCAAAAGGCCGTGGGCAGAGGACCATCCAGCAACAGCCCCGACGAGGCAGCTTTGGCGGCATTATTCCCA
CCATGTTTGAATGAAATTCTGGAAGTCAACCTGGGCTTTCTCGATGTCATTCGTCATGTGCTTGATGAAACAGAG
AAAGATGCCATCACAGATATTGGTCAGGACACGGAGCTGCCTTCTAATCGTCGGGGTTTGCCAAGAGATAGATCG
GATCCGCTTGGAATTCTGGCATTCGCAAAGGCCCTCTTTGAATGGCTACCACAATTTTCACAGCCATATGGAGAC
TACATGCGAGCACATACAGGCTTCACGCAAACTCTGAATTCGTTCATGAAAGATAAGAATTCTAGCTTTTCCAAG
AGAGTATACGAAACGGGAGAGCAGAGACTGCGCTCTCTGTTGATGGAACCCGTCCAGCGACTACCTCGATACAGT
CTGCTGATTGACACCATGACTAGCAATCTGCCCTTGGTCCATCCTGCCGTGCGAACTCTGCTAAAAGCACGAGAC
ATTGTGAAGGATATATGTGCGCTAGAGAATAATTCCCCATCGAGCCACACCCAAAGCCTTCAACGCCTCCAAGAG
CTAGTCAACGGATGGCCAGCGAAAACATTCCCTGAAGGTCGGCTGATTACTGCAGTCGATTTCAACGAAATTACC
CAGCCGTACCGTCTAGACACACAGTCATCTGGCAGAAGCAGCACAGGGATCATGCTTCTTTATAAGAACTGCCTA
GTCCTTCTAGAGAAACCCGCCGAAAGCCGGACTACGGCACGTGGTCTGCTGGCTGATATCGACAATGCGGCCGCT
TCAACCAATGACATGTCCATGTCTTTGCCACAATCCGAACTCCAGGTTGTGCAGGTGCTAGACTTTCATAACGTG
CGTTGTATGCAATCCACGTGTGGTCGAATTTTGTTCGCCGTGCCAATTTCAGCCAAGTCCTCAAAAGAAGAGACA
AGCTCTGACCTGCTTGCATTGGAACTGGCTGGAACGTATGAAGGAAGAGCCAATCGACTGATCGAAGAAATATCC
AAGGCGAAGATTGAGGGTCGATTCCCCGAGAGTGAAAGAGAAGGAGGTAAATGGACGCTAAGAAGCCCTCCCACC
GGGTCTGCGAGTAACGTGGGAATACTCGCCTGTGTGTGCGAGGACGGTGAAAGTGCCGCGCTCGACCAGATTCAG
GCATCCCCAATACGCATTGTTTTTGATACATCCAAGGCGACCTGCGGTCAAATGTTGAGAGGTTCCAACCTTGAG
GTCATCATATCAATATCTCCTCCAAATGGAGATCAATACAGACTAGATATCGATTCTGTGGTTGGATCTGGGTCT
ACAGATTTGATCACGGTGGACACATTTATTTCCACTCTTTCGCGACGTCGTAAGTGACCCTCCCTTGAGAATTAT
ATTTCTTGCCACTGACATAAGAAACAAAGTTCAATATTTGCTCTCGCCTCTGCATAGCGCCCGAAACCCAGCATT
GACGAACTCATTGGTTCATTCTAATTTTGAAATTCTTCGGTACATCGCGAGCAGCTTAATCACGCAGGTCAAGTC
TTCACGGGGCTTCCGGCCACCTTCGCCGACCAAACTAATCTCAAACCTGTTGGGGGGTAGCCGTGATAATGTGCC
CACTCTCAAGGGGCCAGGGTCGGCCACTCTTACCGGCGAATTCCCAAAAATGCCTCCGCCAAGAGTGAATCTGTC
GAGATCGAACACTCTACCTTCGGCATTCCCAGGAAAAGACAAGGACAAGGACAAGGAAAAGGAGAAAGAGAAAGA
GGAAACCGGGAACAGGATATCTGTCGTTGGGACATCTGCCTCCAAGGGATTGGATACTCAGTTCGGGTTGCTGGA
GCAGACATTTGCAGCCTATGTGCTTTCTCTGCAGTCTCGGAGTGGAAACATTCTGGGTCGAATGCTTCGGGTCAG
AGATCACGTTGACCGGGCGCCGGTCAATGAGCTCTACAATATTTTGCTAGAAGACCCGAGCAGAATTCAGGCTGC
CGCCGAAGTGCCAGTTGATACGCTTTTTGTCGCTTTCGAAACCTTTTTGGCGAATGCTTGGAGAACAAGTATGGG
CCCCGTCTTGAGCTCCTCTTCTCTGAAATGGATTCAGAGCCAGTTTGACACCATGATACCGCGGGATTTTGATGA
GCAATTTCGGAAATTTGTGACAGACATGAGCCCGCAAAATAGACGAGCTCTAGCTGCGATTATTCGACTACTTGC
CGAGCTACTCGATGCATCTGGAAATGACGGAGATCGCGGTGCTTTGACGATGGCATTTGCGGAGGTACTCACCGA
AGACGGAGATCCTAGCCATCATGTCTCCCTTTTGGACCGACTGGTCGAAGACTTTGACAACCTCTTTGAAGAATT
TATTCCTGGGGGTACCTCAGTGGAAGGAACACTGACCTGCGATCAATCGAAATCACATGCCAATACCGGGTCAGT
CGGTTCCAATTCTTCCTCTTTCCGGAAACGCTTCGGCTTCGGTATGTCTAGAGATACTCCGAAAAATGAAGGCGA
AAGCAAAGTCGCAGCAATTCTACGGACATTAAGCAAGAAGCAAAGCCCAGCCGGCTCGGAGCTCAATACGCCCAA
GGGTTCTTTGATGCGCTCAAAGTCGACTGATGTGGACTCTCGTCTGGGCTTCCTTCGCCCTACATCGCGCGATCG
TCCTACATCCCGTGATCGCCCTACATCTCGTGATCGCCCTATCTCTCGCGGTAGCCCTGCTTCTCGCGATCGGCC
TTTATCCCGTGACCTTCCGTATCGTCCGTACGGGTTTGCATCTGAGGAGCAAATCTCGAGGCCAGGCACTGGGTA
CGACAACCCACCCTCTCTATCTTCTTTCCGAGGATTCTCTGAGGATAGCGTGCGAAGAACTCGCAAAAAAAGAAG
GAGCTCCCTTTCGGATATACGACCACTCACATCATCCTCAGATGCATCCAGTATCTCTCCAACTCAACAGCTCCG
CCCGACGACCCCTTCCAGTCGCCCTCAAGGAGAAGTGGTAACGCCCACCAACCAGTCCAGGCCTCAGAGCAGTTA
CATACCAACACCACCTATGCGTGGTCAGTCACCAATGCGTTCTAGGCCGCCAGCAAAATCCGGGTCACCGACGCG
ACTAGGATCACCCATTCGCCGTCTGTCTCCGCCCCGCCCTTCGACGCCGAGCAGGAAGGAGAACATTGATCCCAG
GGCTCCACAGATGGAGCGTGCATTTAAGTCCAGGGGCAGTGTATCAGAATCGCCAGCCGATGAGTCAAGGAGGAG
ATCCCAAACGTCAGGCATCCCCCAGCGGATTCCGGGCCTTCGGGAGCGGCCAAGCAGCAACGCTTCCGATACCAA
GCGACCACAATCCTCGTCTGGCTTGCAAAAACCACAGAAACCGCGGATGCAAAGCCCACAAAAGGTTAGTCACAT
TCTATTTCTTTCGATAATGAGTTGACTGACATCCCTTAGTTACGCGATCGTGTTCAACTAGAAAAGAGAACCCAA
AACTCTACCCAATTGGGCCTGAAGGACGAGCTCACGGAGCTTGGTAACGAATTACGTTCTCTGAAGCTCACACCA
CCAAGGAAACCCAACGCAATGAACTTGGAGTTTGATTTTGACCGTACAGACATCAATCCACATGCTGCTACCGCC
GCGTCCCTTGAAGCTCGCATGCGCAATCTTGAAGCCCGATTTGAGACAGTTACTGGGGAATACAAGTGCCGCACA
TCCGCTCTCGAGCGAGACCTGGAGTCGTCCTTGGTTCTTAGCGAGAAGCGTGTTAAGAAATTGGACGAGCTTTAT
CGTGAGGCAAGCGCCGAGAACGAGGCTCTCTATGATCGGTTTAATACCGAGCTCAGCAAGATTGCGAAGGATGTC
CGATTGGGCCACGCAGAAGACGCGTTGAAGTCTCAACTGGCAAGTGCCCTAGACGAGATCGGCCGAGTGAAGAAA
GAAAACTTCCGCTTGAAACGAGAAGTCGGAGGTCTTCGAGCCCAGTCAGCTGCCGCTGCACTGCTGAAGGCGAGC
GAGCAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail