Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g148.t1
Gene name
Locationscaffold_01:373807..378691
Strand+
Gene length (bp)4884
Transcript length (bp)4779
Coding sequence length (bp)4779
Protein length (aa) 1593

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00621 RhoGEF RhoGEF domain 6.0E-21 251 457
PF12015 DUF3507 Domain of unknown function (DUF3507) 2.7E-06 46 147

GO

GO Term Description Terminal node
GO:0005089 Rho guanyl-nucleotide exchange factor activity Yes
GO:0035023 regulation of Rho protein signal transduction Yes
GO:0010646 regulation of cell communication No
GO:0009966 regulation of signal transduction No
GO:0051020 GTPase binding No
GO:0065007 biological regulation No
GO:0005515 protein binding No
GO:0051056 regulation of small GTPase mediated signal transduction No
GO:0031267 small GTPase binding No
GO:0050794 regulation of cellular process No
GO:0050789 regulation of biological process No
GO:0019899 enzyme binding No
GO:0098772 molecular function regulator No
GO:0048583 regulation of response to stimulus No
GO:0046578 regulation of Ras protein signal transduction No
GO:0023051 regulation of signaling No
GO:0005085 guanyl-nucleotide exchange factor activity No
GO:0005088 Ras guanyl-nucleotide exchange factor activity No
GO:0017048 Rho GTPase binding No
GO:0008150 biological_process No
GO:0003674 molecular_function No
GO:1902531 regulation of intracellular signal transduction No
GO:0005488 binding No
GO:0017016 Ras GTPase binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g148.t1
MATIAPPSGICTLADLPLEHLSLYHVVDPCLSSIFVFYGAVSTANATVSSSRIQAHIFTPAGFQSYPRITVSPAA
PVYAAVNHLPREKQGDEVCRGLAVSMLRYFAELSEPVKHRLTGVARTGRPGGKVPKMFDEMHAADLANRMTKVDD
SLEIIQDIRSAYQERKVPWVDIDVVLPTGTIQPFQRRESMGSDLEGGQNPQYGPYTPLIEALGDPMFLPTARLKR
APSQPTNVSKSRLFARSQKEALRLTMCELVDTEERYVAKLYSLVHEVADEFRQKAVGRGPSSNSPDEAALAALFP
PCLNEILEVNLGFLDVIRHVLDETEKDAITDIGQDTELPSNRRGLPRDRSDPLGILAFAKALFEWLPQFSQPYGD
YMRAHTGFTQTLNSFMKDKNSSFSKRVYETGEQRLRSLLMEPVQRLPRYSLLIDTMTSNLPLVHPAVRTLLKARD
IVKDICALENNSPSSHTQSLQRLQELVNGWPAKTFPEGRLITAVDFNEITQPYRLDTQSSGRSSTGIMLLYKNCL
VLLEKPAESRTTARGLLADIDNAAASTNDMSMSLPQSELQVVQVLDFHNVRCMQSTCGRILFAVPISAKSSKEET
SSDLLALELAGTYEGRANRLIEEISKAKIEGRFPESEREGGKWTLRSPPTGSASNVGILACVCEDGESAALDQIQ
ASPIRIVFDTSKATCGQMLRGSNLEVIISISPPNGDQYRLDIDSVVGSGSTDLITVDTFISTLSRRLQYLLSPLH
SARNPALTNSLVHSNFEILRYIASSLITQVKSSRGFRPPSPTKLISNLLGGSRDNVPTLKGPGSATLTGEFPKMP
PPRVNLSRSNTLPSAFPGKDKDKDKEKEKEKEETGNRISVVGTSASKGLDTQFGLLEQTFAAYVLSLQSRSGNIL
GRMLRVRDHVDRAPVNELYNILLEDPSRIQAAAEVPVDTLFVAFETFLANAWRTSMGPVLSSSSLKWIQSQFDTM
IPRDFDEQFRKFVTDMSPQNRRALAAIIRLLAELLDASGNDGDRGALTMAFAEVLTEDGDPSHHVSLLDRLVEDF
DNLFEEFIPGGTSVEGTLTCDQSKSHANTGSVGSNSSSFRKRFGFGMSRDTPKNEGESKVAAILRTLSKKQSPAG
SELNTPKGSLMRSKSTDVDSRLGFLRPTSRDRPTSRDRPTSRDRPISRGSPASRDRPLSRDLPYRPYGFASEEQI
SRPGTGYDNPPSLSSFRGFSEDSVRRTRKKRRSSLSDIRPLTSSSDASSISPTQQLRPTTPSSRPQGEVVTPTNQ
SRPQSSYIPTPPMRGQSPMRSRPPAKSGSPTRLGSPIRRLSPPRPSTPSRKENIDPRAPQMERAFKSRGSVSESP
ADESRRRSQTSGIPQRIPGLRERPSSNASDTKRPQSSSGLQKPQKPRMQSPQKLRDRVQLEKRTQNSTQLGLKDE
LTELGNELRSLKLTPPRKPNAMNLEFDFDRTDINPHAATAASLEARMRNLEARFETVTGEYKCRTSALERDLESS
LVLSEKRVKKLDELYREASAENEALYDRFNTELSKIAKDVRLGHAEDALKSQLASALDEIGRVKKENFRLKREVG
GLRAQSAAAALLKASEQ*
Coding >Pro_DTO377G3_2|g148.t1
ATGGCGACTATCGCACCTCCCTCCGGAATCTGTACACTGGCGGACCTTCCTCTCGAACATCTCAGCCTCTATCAC
GTCGTCGACCCATGTTTATCATCCATCTTCGTCTTCTATGGCGCCGTCTCTACCGCCAATGCTACAGTGAGCAGT
TCCCGTATTCAGGCCCATATATTCACACCCGCCGGGTTTCAAAGTTACCCTCGGATTACGGTGTCCCCGGCTGCC
CCCGTGTATGCTGCGGTCAACCACCTACCCCGCGAAAAACAAGGTGATGAGGTGTGTCGTGGACTTGCAGTCAGC
ATGCTGAGATATTTTGCCGAGCTGTCGGAGCCGGTGAAGCACCGTCTGACTGGGGTGGCTCGCACTGGAAGACCG
GGAGGAAAGGTCCCCAAGATGTTTGATGAGATGCATGCTGCAGATCTTGCCAACCGTATGACAAAGGTGGATGAT
TCTTTGGAGATTATTCAGGATATTCGGAGCGCATATCAGGAACGCAAGGTACCATGGGTCGACATTGATGTGGTG
CTTCCTACGGGTACTATACAACCATTCCAACGGCGAGAGAGTATGGGATCAGATCTTGAGGGAGGTCAGAATCCG
CAGTATGGTCCATACACACCCCTGATAGAGGCGTTGGGAGATCCTATGTTTTTGCCAACAGCTCGATTGAAGCGT
GCGCCGTCCCAGCCGACCAATGTCAGCAAATCACGGCTGTTCGCAAGAAGCCAGAAAGAAGCTCTTCGTCTTACC
ATGTGTGAGCTTGTGGATACCGAAGAGAGATATGTCGCCAAACTTTATTCTCTTGTGCATGAAGTGGCCGACGAG
TTTCGGCAAAAGGCCGTGGGCAGAGGACCATCCAGCAACAGCCCCGACGAGGCAGCTTTGGCGGCATTATTCCCA
CCATGTTTGAATGAAATTCTGGAAGTCAACCTGGGCTTTCTCGATGTCATTCGTCATGTGCTTGATGAAACAGAG
AAAGATGCCATCACAGATATTGGTCAGGACACGGAGCTGCCTTCTAATCGTCGGGGTTTGCCAAGAGATAGATCG
GATCCGCTTGGAATTCTGGCATTCGCAAAGGCCCTCTTTGAATGGCTACCACAATTTTCACAGCCATATGGAGAC
TACATGCGAGCACATACAGGCTTCACGCAAACTCTGAATTCGTTCATGAAAGATAAGAATTCTAGCTTTTCCAAG
AGAGTATACGAAACGGGAGAGCAGAGACTGCGCTCTCTGTTGATGGAACCCGTCCAGCGACTACCTCGATACAGT
CTGCTGATTGACACCATGACTAGCAATCTGCCCTTGGTCCATCCTGCCGTGCGAACTCTGCTAAAAGCACGAGAC
ATTGTGAAGGATATATGTGCGCTAGAGAATAATTCCCCATCGAGCCACACCCAAAGCCTTCAACGCCTCCAAGAG
CTAGTCAACGGATGGCCAGCGAAAACATTCCCTGAAGGTCGGCTGATTACTGCAGTCGATTTCAACGAAATTACC
CAGCCGTACCGTCTAGACACACAGTCATCTGGCAGAAGCAGCACAGGGATCATGCTTCTTTATAAGAACTGCCTA
GTCCTTCTAGAGAAACCCGCCGAAAGCCGGACTACGGCACGTGGTCTGCTGGCTGATATCGACAATGCGGCCGCT
TCAACCAATGACATGTCCATGTCTTTGCCACAATCCGAACTCCAGGTTGTGCAGGTGCTAGACTTTCATAACGTG
CGTTGTATGCAATCCACGTGTGGTCGAATTTTGTTCGCCGTGCCAATTTCAGCCAAGTCCTCAAAAGAAGAGACA
AGCTCTGACCTGCTTGCATTGGAACTGGCTGGAACGTATGAAGGAAGAGCCAATCGACTGATCGAAGAAATATCC
AAGGCGAAGATTGAGGGTCGATTCCCCGAGAGTGAAAGAGAAGGAGGTAAATGGACGCTAAGAAGCCCTCCCACC
GGGTCTGCGAGTAACGTGGGAATACTCGCCTGTGTGTGCGAGGACGGTGAAAGTGCCGCGCTCGACCAGATTCAG
GCATCCCCAATACGCATTGTTTTTGATACATCCAAGGCGACCTGCGGTCAAATGTTGAGAGGTTCCAACCTTGAG
GTCATCATATCAATATCTCCTCCAAATGGAGATCAATACAGACTAGATATCGATTCTGTGGTTGGATCTGGGTCT
ACAGATTTGATCACGGTGGACACATTTATTTCCACTCTTTCGCGACGTCTTCAATATTTGCTCTCGCCTCTGCAT
AGCGCCCGAAACCCAGCATTGACGAACTCATTGGTTCATTCTAATTTTGAAATTCTTCGGTACATCGCGAGCAGC
TTAATCACGCAGGTCAAGTCTTCACGGGGCTTCCGGCCACCTTCGCCGACCAAACTAATCTCAAACCTGTTGGGG
GGTAGCCGTGATAATGTGCCCACTCTCAAGGGGCCAGGGTCGGCCACTCTTACCGGCGAATTCCCAAAAATGCCT
CCGCCAAGAGTGAATCTGTCGAGATCGAACACTCTACCTTCGGCATTCCCAGGAAAAGACAAGGACAAGGACAAG
GAAAAGGAGAAAGAGAAAGAGGAAACCGGGAACAGGATATCTGTCGTTGGGACATCTGCCTCCAAGGGATTGGAT
ACTCAGTTCGGGTTGCTGGAGCAGACATTTGCAGCCTATGTGCTTTCTCTGCAGTCTCGGAGTGGAAACATTCTG
GGTCGAATGCTTCGGGTCAGAGATCACGTTGACCGGGCGCCGGTCAATGAGCTCTACAATATTTTGCTAGAAGAC
CCGAGCAGAATTCAGGCTGCCGCCGAAGTGCCAGTTGATACGCTTTTTGTCGCTTTCGAAACCTTTTTGGCGAAT
GCTTGGAGAACAAGTATGGGCCCCGTCTTGAGCTCCTCTTCTCTGAAATGGATTCAGAGCCAGTTTGACACCATG
ATACCGCGGGATTTTGATGAGCAATTTCGGAAATTTGTGACAGACATGAGCCCGCAAAATAGACGAGCTCTAGCT
GCGATTATTCGACTACTTGCCGAGCTACTCGATGCATCTGGAAATGACGGAGATCGCGGTGCTTTGACGATGGCA
TTTGCGGAGGTACTCACCGAAGACGGAGATCCTAGCCATCATGTCTCCCTTTTGGACCGACTGGTCGAAGACTTT
GACAACCTCTTTGAAGAATTTATTCCTGGGGGTACCTCAGTGGAAGGAACACTGACCTGCGATCAATCGAAATCA
CATGCCAATACCGGGTCAGTCGGTTCCAATTCTTCCTCTTTCCGGAAACGCTTCGGCTTCGGTATGTCTAGAGAT
ACTCCGAAAAATGAAGGCGAAAGCAAAGTCGCAGCAATTCTACGGACATTAAGCAAGAAGCAAAGCCCAGCCGGC
TCGGAGCTCAATACGCCCAAGGGTTCTTTGATGCGCTCAAAGTCGACTGATGTGGACTCTCGTCTGGGCTTCCTT
CGCCCTACATCGCGCGATCGTCCTACATCCCGTGATCGCCCTACATCTCGTGATCGCCCTATCTCTCGCGGTAGC
CCTGCTTCTCGCGATCGGCCTTTATCCCGTGACCTTCCGTATCGTCCGTACGGGTTTGCATCTGAGGAGCAAATC
TCGAGGCCAGGCACTGGGTACGACAACCCACCCTCTCTATCTTCTTTCCGAGGATTCTCTGAGGATAGCGTGCGA
AGAACTCGCAAAAAAAGAAGGAGCTCCCTTTCGGATATACGACCACTCACATCATCCTCAGATGCATCCAGTATC
TCTCCAACTCAACAGCTCCGCCCGACGACCCCTTCCAGTCGCCCTCAAGGAGAAGTGGTAACGCCCACCAACCAG
TCCAGGCCTCAGAGCAGTTACATACCAACACCACCTATGCGTGGTCAGTCACCAATGCGTTCTAGGCCGCCAGCA
AAATCCGGGTCACCGACGCGACTAGGATCACCCATTCGCCGTCTGTCTCCGCCCCGCCCTTCGACGCCGAGCAGG
AAGGAGAACATTGATCCCAGGGCTCCACAGATGGAGCGTGCATTTAAGTCCAGGGGCAGTGTATCAGAATCGCCA
GCCGATGAGTCAAGGAGGAGATCCCAAACGTCAGGCATCCCCCAGCGGATTCCGGGCCTTCGGGAGCGGCCAAGC
AGCAACGCTTCCGATACCAAGCGACCACAATCCTCGTCTGGCTTGCAAAAACCACAGAAACCGCGGATGCAAAGC
CCACAAAAGTTACGCGATCGTGTTCAACTAGAAAAGAGAACCCAAAACTCTACCCAATTGGGCCTGAAGGACGAG
CTCACGGAGCTTGGTAACGAATTACGTTCTCTGAAGCTCACACCACCAAGGAAACCCAACGCAATGAACTTGGAG
TTTGATTTTGACCGTACAGACATCAATCCACATGCTGCTACCGCCGCGTCCCTTGAAGCTCGCATGCGCAATCTT
GAAGCCCGATTTGAGACAGTTACTGGGGAATACAAGTGCCGCACATCCGCTCTCGAGCGAGACCTGGAGTCGTCC
TTGGTTCTTAGCGAGAAGCGTGTTAAGAAATTGGACGAGCTTTATCGTGAGGCAAGCGCCGAGAACGAGGCTCTC
TATGATCGGTTTAATACCGAGCTCAGCAAGATTGCGAAGGATGTCCGATTGGGCCACGCAGAAGACGCGTTGAAG
TCTCAACTGGCAAGTGCCCTAGACGAGATCGGCCGAGTGAAGAAAGAAAACTTCCGCTTGAAACGAGAAGTCGGA
GGTCTTCGAGCCCAGTCAGCTGCCGCTGCACTGCTGAAGGCGAGCGAGCAATGA
Transcript >Pro_DTO377G3_2|g148.t1
ATGGCGACTATCGCACCTCCCTCCGGAATCTGTACACTGGCGGACCTTCCTCTCGAACATCTCAGCCTCTATCAC
GTCGTCGACCCATGTTTATCATCCATCTTCGTCTTCTATGGCGCCGTCTCTACCGCCAATGCTACAGTGAGCAGT
TCCCGTATTCAGGCCCATATATTCACACCCGCCGGGTTTCAAAGTTACCCTCGGATTACGGTGTCCCCGGCTGCC
CCCGTGTATGCTGCGGTCAACCACCTACCCCGCGAAAAACAAGGTGATGAGGTGTGTCGTGGACTTGCAGTCAGC
ATGCTGAGATATTTTGCCGAGCTGTCGGAGCCGGTGAAGCACCGTCTGACTGGGGTGGCTCGCACTGGAAGACCG
GGAGGAAAGGTCCCCAAGATGTTTGATGAGATGCATGCTGCAGATCTTGCCAACCGTATGACAAAGGTGGATGAT
TCTTTGGAGATTATTCAGGATATTCGGAGCGCATATCAGGAACGCAAGGTACCATGGGTCGACATTGATGTGGTG
CTTCCTACGGGTACTATACAACCATTCCAACGGCGAGAGAGTATGGGATCAGATCTTGAGGGAGGTCAGAATCCG
CAGTATGGTCCATACACACCCCTGATAGAGGCGTTGGGAGATCCTATGTTTTTGCCAACAGCTCGATTGAAGCGT
GCGCCGTCCCAGCCGACCAATGTCAGCAAATCACGGCTGTTCGCAAGAAGCCAGAAAGAAGCTCTTCGTCTTACC
ATGTGTGAGCTTGTGGATACCGAAGAGAGATATGTCGCCAAACTTTATTCTCTTGTGCATGAAGTGGCCGACGAG
TTTCGGCAAAAGGCCGTGGGCAGAGGACCATCCAGCAACAGCCCCGACGAGGCAGCTTTGGCGGCATTATTCCCA
CCATGTTTGAATGAAATTCTGGAAGTCAACCTGGGCTTTCTCGATGTCATTCGTCATGTGCTTGATGAAACAGAG
AAAGATGCCATCACAGATATTGGTCAGGACACGGAGCTGCCTTCTAATCGTCGGGGTTTGCCAAGAGATAGATCG
GATCCGCTTGGAATTCTGGCATTCGCAAAGGCCCTCTTTGAATGGCTACCACAATTTTCACAGCCATATGGAGAC
TACATGCGAGCACATACAGGCTTCACGCAAACTCTGAATTCGTTCATGAAAGATAAGAATTCTAGCTTTTCCAAG
AGAGTATACGAAACGGGAGAGCAGAGACTGCGCTCTCTGTTGATGGAACCCGTCCAGCGACTACCTCGATACAGT
CTGCTGATTGACACCATGACTAGCAATCTGCCCTTGGTCCATCCTGCCGTGCGAACTCTGCTAAAAGCACGAGAC
ATTGTGAAGGATATATGTGCGCTAGAGAATAATTCCCCATCGAGCCACACCCAAAGCCTTCAACGCCTCCAAGAG
CTAGTCAACGGATGGCCAGCGAAAACATTCCCTGAAGGTCGGCTGATTACTGCAGTCGATTTCAACGAAATTACC
CAGCCGTACCGTCTAGACACACAGTCATCTGGCAGAAGCAGCACAGGGATCATGCTTCTTTATAAGAACTGCCTA
GTCCTTCTAGAGAAACCCGCCGAAAGCCGGACTACGGCACGTGGTCTGCTGGCTGATATCGACAATGCGGCCGCT
TCAACCAATGACATGTCCATGTCTTTGCCACAATCCGAACTCCAGGTTGTGCAGGTGCTAGACTTTCATAACGTG
CGTTGTATGCAATCCACGTGTGGTCGAATTTTGTTCGCCGTGCCAATTTCAGCCAAGTCCTCAAAAGAAGAGACA
AGCTCTGACCTGCTTGCATTGGAACTGGCTGGAACGTATGAAGGAAGAGCCAATCGACTGATCGAAGAAATATCC
AAGGCGAAGATTGAGGGTCGATTCCCCGAGAGTGAAAGAGAAGGAGGTAAATGGACGCTAAGAAGCCCTCCCACC
GGGTCTGCGAGTAACGTGGGAATACTCGCCTGTGTGTGCGAGGACGGTGAAAGTGCCGCGCTCGACCAGATTCAG
GCATCCCCAATACGCATTGTTTTTGATACATCCAAGGCGACCTGCGGTCAAATGTTGAGAGGTTCCAACCTTGAG
GTCATCATATCAATATCTCCTCCAAATGGAGATCAATACAGACTAGATATCGATTCTGTGGTTGGATCTGGGTCT
ACAGATTTGATCACGGTGGACACATTTATTTCCACTCTTTCGCGACGTCTTCAATATTTGCTCTCGCCTCTGCAT
AGCGCCCGAAACCCAGCATTGACGAACTCATTGGTTCATTCTAATTTTGAAATTCTTCGGTACATCGCGAGCAGC
TTAATCACGCAGGTCAAGTCTTCACGGGGCTTCCGGCCACCTTCGCCGACCAAACTAATCTCAAACCTGTTGGGG
GGTAGCCGTGATAATGTGCCCACTCTCAAGGGGCCAGGGTCGGCCACTCTTACCGGCGAATTCCCAAAAATGCCT
CCGCCAAGAGTGAATCTGTCGAGATCGAACACTCTACCTTCGGCATTCCCAGGAAAAGACAAGGACAAGGACAAG
GAAAAGGAGAAAGAGAAAGAGGAAACCGGGAACAGGATATCTGTCGTTGGGACATCTGCCTCCAAGGGATTGGAT
ACTCAGTTCGGGTTGCTGGAGCAGACATTTGCAGCCTATGTGCTTTCTCTGCAGTCTCGGAGTGGAAACATTCTG
GGTCGAATGCTTCGGGTCAGAGATCACGTTGACCGGGCGCCGGTCAATGAGCTCTACAATATTTTGCTAGAAGAC
CCGAGCAGAATTCAGGCTGCCGCCGAAGTGCCAGTTGATACGCTTTTTGTCGCTTTCGAAACCTTTTTGGCGAAT
GCTTGGAGAACAAGTATGGGCCCCGTCTTGAGCTCCTCTTCTCTGAAATGGATTCAGAGCCAGTTTGACACCATG
ATACCGCGGGATTTTGATGAGCAATTTCGGAAATTTGTGACAGACATGAGCCCGCAAAATAGACGAGCTCTAGCT
GCGATTATTCGACTACTTGCCGAGCTACTCGATGCATCTGGAAATGACGGAGATCGCGGTGCTTTGACGATGGCA
TTTGCGGAGGTACTCACCGAAGACGGAGATCCTAGCCATCATGTCTCCCTTTTGGACCGACTGGTCGAAGACTTT
GACAACCTCTTTGAAGAATTTATTCCTGGGGGTACCTCAGTGGAAGGAACACTGACCTGCGATCAATCGAAATCA
CATGCCAATACCGGGTCAGTCGGTTCCAATTCTTCCTCTTTCCGGAAACGCTTCGGCTTCGGTATGTCTAGAGAT
ACTCCGAAAAATGAAGGCGAAAGCAAAGTCGCAGCAATTCTACGGACATTAAGCAAGAAGCAAAGCCCAGCCGGC
TCGGAGCTCAATACGCCCAAGGGTTCTTTGATGCGCTCAAAGTCGACTGATGTGGACTCTCGTCTGGGCTTCCTT
CGCCCTACATCGCGCGATCGTCCTACATCCCGTGATCGCCCTACATCTCGTGATCGCCCTATCTCTCGCGGTAGC
CCTGCTTCTCGCGATCGGCCTTTATCCCGTGACCTTCCGTATCGTCCGTACGGGTTTGCATCTGAGGAGCAAATC
TCGAGGCCAGGCACTGGGTACGACAACCCACCCTCTCTATCTTCTTTCCGAGGATTCTCTGAGGATAGCGTGCGA
AGAACTCGCAAAAAAAGAAGGAGCTCCCTTTCGGATATACGACCACTCACATCATCCTCAGATGCATCCAGTATC
TCTCCAACTCAACAGCTCCGCCCGACGACCCCTTCCAGTCGCCCTCAAGGAGAAGTGGTAACGCCCACCAACCAG
TCCAGGCCTCAGAGCAGTTACATACCAACACCACCTATGCGTGGTCAGTCACCAATGCGTTCTAGGCCGCCAGCA
AAATCCGGGTCACCGACGCGACTAGGATCACCCATTCGCCGTCTGTCTCCGCCCCGCCCTTCGACGCCGAGCAGG
AAGGAGAACATTGATCCCAGGGCTCCACAGATGGAGCGTGCATTTAAGTCCAGGGGCAGTGTATCAGAATCGCCA
GCCGATGAGTCAAGGAGGAGATCCCAAACGTCAGGCATCCCCCAGCGGATTCCGGGCCTTCGGGAGCGGCCAAGC
AGCAACGCTTCCGATACCAAGCGACCACAATCCTCGTCTGGCTTGCAAAAACCACAGAAACCGCGGATGCAAAGC
CCACAAAAGTTACGCGATCGTGTTCAACTAGAAAAGAGAACCCAAAACTCTACCCAATTGGGCCTGAAGGACGAG
CTCACGGAGCTTGGTAACGAATTACGTTCTCTGAAGCTCACACCACCAAGGAAACCCAACGCAATGAACTTGGAG
TTTGATTTTGACCGTACAGACATCAATCCACATGCTGCTACCGCCGCGTCCCTTGAAGCTCGCATGCGCAATCTT
GAAGCCCGATTTGAGACAGTTACTGGGGAATACAAGTGCCGCACATCCGCTCTCGAGCGAGACCTGGAGTCGTCC
TTGGTTCTTAGCGAGAAGCGTGTTAAGAAATTGGACGAGCTTTATCGTGAGGCAAGCGCCGAGAACGAGGCTCTC
TATGATCGGTTTAATACCGAGCTCAGCAAGATTGCGAAGGATGTCCGATTGGGCCACGCAGAAGACGCGTTGAAG
TCTCAACTGGCAAGTGCCCTAGACGAGATCGGCCGAGTGAAGAAAGAAAACTTCCGCTTGAAACGAGAAGTCGGA
GGTCTTCGAGCCCAGTCAGCTGCCGCTGCACTGCTGAAGGCGAGCGAGCAATGA
Gene >Pro_DTO377G3_2|g148.t1
ATGGCGACTATCGCACCTCCCTCCGGAATCTGTACACTGGCGGACCTTCCTCTCGAACATCTCAGCCTCTATCAC
GTCGTCGACCCATGTTTATCATCCATCTTCGTCTTCTATGGCGCCGTCTCTACCGCCAATGCTACAGTGAGCAGT
TCCCGTATTCAGGCCCATATATTCACACCCGCCGGGTTTCAAAGTTACCCTCGGATTACGGTGTCCCCGGCTGCC
CCCGTGTATGCTGCGGTCAACCACCTACCCCGCGAAAAACAAGGTGATGAGGTGTGTCGTGGACTTGCAGTCAGC
ATGCTGAGATATTTTGCCGAGCTGTCGGAGCCGGTGAAGCACCGTCTGACTGGGGTGGCTCGCACTGGAAGACCG
GGAGGAAAGGTCCCCAAGATGTTTGATGAGATGCATGCTGCAGATCTTGCCAACCGTATGACAAAGGTGGATGAT
TCTTTGGAGATTATTCAGGATATTCGGAGCGCATATCAGGAACGCAAGGTACCATGGGTCGACATTGATGTGGTG
CTTCCTACGGGTACTATACAACCATTCCAACGGCGAGAGAGTATGGGATCAGATCTTGAGGGAGGTCAGAATCCG
CAGTATGGTCCATACACACCCCTGATAGAGGCGTTGGGAGATCCTATGTTTTTGCCAACAGCTCGATTGAAGCGT
GCGCCGTCCCAGCCGACCAATGTCAGCAAATCACGGCTGTTCGCAAGAAGCCAGAAAGAAGCTCTTCGTCTTACC
ATGTGTGAGCTTGTGGATACCGAAGAGAGATATGTCGCCAAACTTTATTCTCTTGTGCATGAAGTGGCCGACGAG
TTTCGGCAAAAGGCCGTGGGCAGAGGACCATCCAGCAACAGCCCCGACGAGGCAGCTTTGGCGGCATTATTCCCA
CCATGTTTGAATGAAATTCTGGAAGTCAACCTGGGCTTTCTCGATGTCATTCGTCATGTGCTTGATGAAACAGAG
AAAGATGCCATCACAGATATTGGTCAGGACACGGAGCTGCCTTCTAATCGTCGGGGTTTGCCAAGAGATAGATCG
GATCCGCTTGGAATTCTGGCATTCGCAAAGGCCCTCTTTGAATGGCTACCACAATTTTCACAGCCATATGGAGAC
TACATGCGAGCACATACAGGCTTCACGCAAACTCTGAATTCGTTCATGAAAGATAAGAATTCTAGCTTTTCCAAG
AGAGTATACGAAACGGGAGAGCAGAGACTGCGCTCTCTGTTGATGGAACCCGTCCAGCGACTACCTCGATACAGT
CTGCTGATTGACACCATGACTAGCAATCTGCCCTTGGTCCATCCTGCCGTGCGAACTCTGCTAAAAGCACGAGAC
ATTGTGAAGGATATATGTGCGCTAGAGAATAATTCCCCATCGAGCCACACCCAAAGCCTTCAACGCCTCCAAGAG
CTAGTCAACGGATGGCCAGCGAAAACATTCCCTGAAGGTCGGCTGATTACTGCAGTCGATTTCAACGAAATTACC
CAGCCGTACCGTCTAGACACACAGTCATCTGGCAGAAGCAGCACAGGGATCATGCTTCTTTATAAGAACTGCCTA
GTCCTTCTAGAGAAACCCGCCGAAAGCCGGACTACGGCACGTGGTCTGCTGGCTGATATCGACAATGCGGCCGCT
TCAACCAATGACATGTCCATGTCTTTGCCACAATCCGAACTCCAGGTTGTGCAGGTGCTAGACTTTCATAACGTG
CGTTGTATGCAATCCACGTGTGGTCGAATTTTGTTCGCCGTGCCAATTTCAGCCAAGTCCTCAAAAGAAGAGACA
AGCTCTGACCTGCTTGCATTGGAACTGGCTGGAACGTATGAAGGAAGAGCCAATCGACTGATCGAAGAAATATCC
AAGGCGAAGATTGAGGGTCGATTCCCCGAGAGTGAAAGAGAAGGAGGTAAATGGACGCTAAGAAGCCCTCCCACC
GGGTCTGCGAGTAACGTGGGAATACTCGCCTGTGTGTGCGAGGACGGTGAAAGTGCCGCGCTCGACCAGATTCAG
GCATCCCCAATACGCATTGTTTTTGATACATCCAAGGCGACCTGCGGTCAAATGTTGAGAGGTTCCAACCTTGAG
GTCATCATATCAATATCTCCTCCAAATGGAGATCAATACAGACTAGATATCGATTCTGTGGTTGGATCTGGGTCT
ACAGATTTGATCACGGTGGACACATTTATTTCCACTCTTTCGCGACGTCGTAAGTGACCCTCCCTTGAGAATTAT
ATTTCTTGCCACTGACATAAGAAACAAAGTTCAATATTTGCTCTCGCCTCTGCATAGCGCCCGAAACCCAGCATT
GACGAACTCATTGGTTCATTCTAATTTTGAAATTCTTCGGTACATCGCGAGCAGCTTAATCACGCAGGTCAAGTC
TTCACGGGGCTTCCGGCCACCTTCGCCGACCAAACTAATCTCAAACCTGTTGGGGGGTAGCCGTGATAATGTGCC
CACTCTCAAGGGGCCAGGGTCGGCCACTCTTACCGGCGAATTCCCAAAAATGCCTCCGCCAAGAGTGAATCTGTC
GAGATCGAACACTCTACCTTCGGCATTCCCAGGAAAAGACAAGGACAAGGACAAGGAAAAGGAGAAAGAGAAAGA
GGAAACCGGGAACAGGATATCTGTCGTTGGGACATCTGCCTCCAAGGGATTGGATACTCAGTTCGGGTTGCTGGA
GCAGACATTTGCAGCCTATGTGCTTTCTCTGCAGTCTCGGAGTGGAAACATTCTGGGTCGAATGCTTCGGGTCAG
AGATCACGTTGACCGGGCGCCGGTCAATGAGCTCTACAATATTTTGCTAGAAGACCCGAGCAGAATTCAGGCTGC
CGCCGAAGTGCCAGTTGATACGCTTTTTGTCGCTTTCGAAACCTTTTTGGCGAATGCTTGGAGAACAAGTATGGG
CCCCGTCTTGAGCTCCTCTTCTCTGAAATGGATTCAGAGCCAGTTTGACACCATGATACCGCGGGATTTTGATGA
GCAATTTCGGAAATTTGTGACAGACATGAGCCCGCAAAATAGACGAGCTCTAGCTGCGATTATTCGACTACTTGC
CGAGCTACTCGATGCATCTGGAAATGACGGAGATCGCGGTGCTTTGACGATGGCATTTGCGGAGGTACTCACCGA
AGACGGAGATCCTAGCCATCATGTCTCCCTTTTGGACCGACTGGTCGAAGACTTTGACAACCTCTTTGAAGAATT
TATTCCTGGGGGTACCTCAGTGGAAGGAACACTGACCTGCGATCAATCGAAATCACATGCCAATACCGGGTCAGT
CGGTTCCAATTCTTCCTCTTTCCGGAAACGCTTCGGCTTCGGTATGTCTAGAGATACTCCGAAAAATGAAGGCGA
AAGCAAAGTCGCAGCAATTCTACGGACATTAAGCAAGAAGCAAAGCCCAGCCGGCTCGGAGCTCAATACGCCCAA
GGGTTCTTTGATGCGCTCAAAGTCGACTGATGTGGACTCTCGTCTGGGCTTCCTTCGCCCTACATCGCGCGATCG
TCCTACATCCCGTGATCGCCCTACATCTCGTGATCGCCCTATCTCTCGCGGTAGCCCTGCTTCTCGCGATCGGCC
TTTATCCCGTGACCTTCCGTATCGTCCGTACGGGTTTGCATCTGAGGAGCAAATCTCGAGGCCAGGCACTGGGTA
CGACAACCCACCCTCTCTATCTTCTTTCCGAGGATTCTCTGAGGATAGCGTGCGAAGAACTCGCAAAAAAAGAAG
GAGCTCCCTTTCGGATATACGACCACTCACATCATCCTCAGATGCATCCAGTATCTCTCCAACTCAACAGCTCCG
CCCGACGACCCCTTCCAGTCGCCCTCAAGGAGAAGTGGTAACGCCCACCAACCAGTCCAGGCCTCAGAGCAGTTA
CATACCAACACCACCTATGCGTGGTCAGTCACCAATGCGTTCTAGGCCGCCAGCAAAATCCGGGTCACCGACGCG
ACTAGGATCACCCATTCGCCGTCTGTCTCCGCCCCGCCCTTCGACGCCGAGCAGGAAGGAGAACATTGATCCCAG
GGCTCCACAGATGGAGCGTGCATTTAAGTCCAGGGGCAGTGTATCAGAATCGCCAGCCGATGAGTCAAGGAGGAG
ATCCCAAACGTCAGGCATCCCCCAGCGGATTCCGGGCCTTCGGGAGCGGCCAAGCAGCAACGCTTCCGATACCAA
GCGACCACAATCCTCGTCTGGCTTGCAAAAACCACAGAAACCGCGGATGCAAAGCCCACAAAAGGTTAGTCACAT
TCTATTTCTTTCGATAATGAGTTGACTGACATCCCTTAGTTACGCGATCGTGTTCAACTAGAAAAGAGAACCCAA
AACTCTACCCAATTGGGCCTGAAGGACGAGCTCACGGAGCTTGGTAACGAATTACGTTCTCTGAAGCTCACACCA
CCAAGGAAACCCAACGCAATGAACTTGGAGTTTGATTTTGACCGTACAGACATCAATCCACATGCTGCTACCGCC
GCGTCCCTTGAAGCTCGCATGCGCAATCTTGAAGCCCGATTTGAGACAGTTACTGGGGAATACAAGTGCCGCACA
TCCGCTCTCGAGCGAGACCTGGAGTCGTCCTTGGTTCTTAGCGAGAAGCGTGTTAAGAAATTGGACGAGCTTTAT
CGTGAGGCAAGCGCCGAGAACGAGGCTCTCTATGATCGGTTTAATACCGAGCTCAGCAAGATTGCGAAGGATGTC
CGATTGGGCCACGCAGAAGACGCGTTGAAGTCTCAACTGGCAAGTGCCCTAGACGAGATCGGCCGAGTGAAGAAA
GAAAACTTCCGCTTGAAACGAGAAGTCGGAGGTCTTCGAGCCCAGTCAGCTGCCGCTGCACTGCTGAAGGCGAGC
GAGCAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail