Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g1474.t1
Gene name
Locationscaffold_02:61153..64546
Strand+
Gene length (bp)3393
Transcript length (bp)3342
Coding sequence length (bp)3342
Protein length (aa) 1114

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00617 RasGEF RasGEF domain 2.9E-51 828 1011
PF00618 RasGEF_N RasGEF N-terminal motif 2.0E-14 649 741
PF00018 SH3_1 SH3 domain 3.4E-05 47 82

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0007264 small GTPase mediated signal transduction Yes
GO:0005085 guanyl-nucleotide exchange factor activity Yes
GO:0008150 biological_process No
GO:0009987 cellular process No
GO:0005488 binding No
GO:0065007 biological regulation No
GO:0007165 signal transduction No
GO:0051020 GTPase binding No
GO:0098772 molecular function regulator No
GO:0019899 enzyme binding No
GO:0050794 regulation of cellular process No
GO:0050789 regulation of biological process No
GO:0003674 molecular_function No
GO:0035556 intracellular signal transduction No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 31 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g1474.t1
MTPPLTPQNAQDTNMDQLEAPRPVFHNYLRAFYPFHPAGNVSPSTVTLPLDQGDIILVHSVHTNGWADGTLLDSG
NRGWLPTNYCEAYDQLPMRPLLKALTDFWDIIRGNFGSSLKDFGNQDLMRGPIAGVRFLLEKSECLTRESALVRR
FEGLRRIRKALLSDLSSLVKTAKKFQEIANGLPSEDEVEAILDEMLLKAFKIVTRGVRFLDVWNEEVGLGRTIAE
MDGPNESSGQYSMPPTPASETFNLGENEGPDRSASRMLESRMDHSRMDMSRSSMRTEMVDPRPASVATKRVSVSH
RMSVSGPSTAIVAQNLASERLGTTYDAFLGVLGSFLGFHMQSRSSMELVVTTQQAVEACKQLLNVIEVVCEHGTH
RSAFLEQARELMWEKLSELVHAARDVFRPAQMPEDDLFFMVDEGKRLVGAATDCVRAAGNCLAKARLVLEQIGDL
ELDPEHFEEERQELSSVASPQDEPQTPVEEERQEMSRLPPPPLQIPSTPALTDATTPSSFQSLPANSPANITAIS
SLPNSAILPTHLENISSFSSTDSNYRESHPKSDMSESFGRGITSNGSSFTYNSHARDSEMSGVSQTSTRATSPDI
GGSFQGSFKVHSLKESLSYSTLAEENEETEANILEKTFAHELIYKEGSVMGGSLRALIEKLTAHQSTPDAMFVST
FYLTFRLFATPLEFAEALAERFDYIGETPHAAGPVRLRVYNIFKGWLESHWRHDRDNTALEFIVDFASTRLMADL
PTAGMRLLDLAGKVSSVGGPLVPRLISSMGKTNTSIAQYIHPDTPLPPPILGKKEHHLLKQWKNGEASITILDFD
PLELARQLTIKESRIFCSILPEELLNTEWTPKSGSLAVNVRAMSTLSTDLAHLVADSILYLEEPKKRAATIKHWV
KIANKCLELNNYDSLMAIICSLNSSMISRLKKTWDIVSQKTKTVLEQLCGIVDVSRNYAVLRQRLQNHVPPCLPF
VGTYLTDLTFVDHGNQSLRTLSTHDSEMTVINFDKHMKTARIISELQRFQIPYRLTEVPELQVWMQNEFVRVRSN
GEITTQTFYRRSLVLEPREASRSANNLQSQSEPMPSMLDNAKDKFDFLSWTNHPKAKSVPTHG*
Coding >Pro_DTO377G3_2|g1474.t1
ATGACCCCTCCGTTAACGCCACAAAACGCCCAGGACACAAACATGGATCAATTGGAAGCCCCGAGGCCTGTCTTT
CACAACTATCTGCGCGCCTTCTACCCTTTTCACCCGGCTGGCAATGTCTCTCCTTCGACCGTTACACTCCCGCTG
GACCAGGGAGATATCATTTTGGTACACTCCGTTCACACCAATGGCTGGGCCGATGGTACATTATTAGATTCTGGG
AATCGCGGCTGGTTACCCACGAATTACTGCGAGGCTTACGACCAATTACCCATGCGTCCTTTGTTGAAGGCCTTG
ACTGATTTCTGGGATATCATTCGAGGAAACTTCGGGTCATCACTGAAGGACTTTGGAAATCAAGACTTGATGAGA
GGCCCTATCGCTGGCGTCCGCTTTCTACTAGAAAAATCAGAATGTCTTACTCGAGAATCCGCTCTGGTAAGGCGA
TTTGAGGGACTACGCAGAATTCGAAAGGCTTTGCTATCTGACCTGTCTTCGCTGGTGAAAACTGCGAAAAAGTTC
CAGGAAATTGCAAACGGGCTCCCGTCAGAAGACGAGGTTGAGGCCATTCTGGATGAGATGCTTCTCAAGGCTTTC
AAGATTGTTACTAGAGGAGTTCGATTCCTCGACGTCTGGAACGAGGAGGTAGGCTTGGGTCGGACTATCGCCGAG
ATGGATGGGCCCAACGAAAGCTCAGGCCAGTATAGCATGCCACCGACTCCTGCATCCGAAACTTTCAACTTGGGC
GAGAACGAGGGACCTGATCGATCTGCGTCGCGAATGCTGGAATCACGAATGGACCATAGCCGGATGGATATGAGT
CGATCATCGATGCGCACGGAGATGGTTGATCCTAGACCGGCCTCCGTCGCTACCAAACGGGTTTCTGTATCCCAC
CGCATGTCAGTCTCCGGCCCTTCGACTGCCATCGTTGCCCAGAATCTGGCATCCGAACGCCTGGGAACAACATAT
GATGCATTCCTCGGCGTACTTGGCTCATTCCTCGGGTTCCATATGCAGTCCCGCTCCTCGATGGAGTTGGTTGTC
ACTACACAGCAGGCTGTCGAGGCATGCAAGCAATTGCTAAACGTCATTGAGGTAGTATGTGAGCATGGTACACAT
CGCAGCGCGTTTCTCGAACAGGCACGAGAGTTAATGTGGGAGAAGCTATCTGAGCTCGTTCACGCTGCACGCGAC
GTGTTTCGTCCCGCACAAATGCCAGAAGATGATCTATTTTTCATGGTAGATGAAGGAAAACGCCTTGTGGGTGCT
GCGACTGACTGTGTCCGAGCAGCTGGAAACTGTTTGGCCAAGGCTCGCCTGGTGCTTGAGCAAATTGGTGACCTT
GAGCTTGACCCTGAACACTTCGAAGAGGAAAGACAGGAATTGTCTAGCGTTGCCTCTCCACAAGATGAACCGCAG
ACTCCCGTAGAAGAAGAGCGACAGGAGATGTCACGTCTTCCCCCACCTCCTCTTCAGATCCCTAGCACACCTGCT
CTCACCGACGCTACAACACCTTCATCCTTTCAGTCTCTTCCTGCAAATTCCCCCGCCAACATCACCGCCATTTCT
TCTTTACCTAATTCTGCCATACTCCCCACCCACCTCGAGAACATCTCTTCCTTCTCCTCCACTGACAGTAACTAC
CGTGAAAGTCATCCCAAGTCTGATATGAGCGAATCATTCGGACGTGGAATTACAAGCAATGGCAGCAGCTTCACG
TATAATAGCCATGCACGTGATTCTGAGATGAGTGGCGTTTCCCAAACCTCGACTCGGGCTACCTCGCCTGATATT
GGGGGTAGCTTCCAGGGTAGCTTCAAGGTTCACTCGCTGAAGGAGAGTCTGAGCTACTCCACCCTCGCCGAGGAA
AATGAGGAGACTGAGGCCAACATCCTGGAGAAGACTTTCGCACACGAACTTATTTACAAGGAAGGTTCGGTGATG
GGCGGGAGTTTGCGTGCTCTTATTGAGAAGCTGACTGCTCATCAATCTACCCCCGATGCCATGTTTGTTTCAACC
TTCTACCTCACCTTCCGTCTGTTTGCTACGCCTCTTGAGTTTGCCGAGGCCCTCGCTGAACGCTTCGACTATATT
GGTGAGACACCCCACGCCGCCGGACCCGTCCGTCTGCGTGTATACAACATCTTCAAGGGCTGGCTCGAGTCGCAC
TGGCGCCACGACCGCGACAACACGGCCCTGGAGTTCATCGTCGACTTCGCAAGCACACGACTTATGGCGGACCTT
CCCACTGCTGGTATGAGGTTGCTTGATTTGGCCGGCAAGGTGTCCTCCGTTGGTGGTCCTCTTGTGCCTCGCCTG
ATATCTTCCATGGGCAAGACCAACACTTCCATTGCCCAATACATTCACCCCGATACTCCCTTACCCCCTCCCATC
CTTGGCAAGAAGGAGCACCACTTGCTCAAGCAATGGAAGAACGGCGAAGCCTCTATAACCATCCTTGACTTCGAC
CCACTTGAGCTCGCCCGCCAGCTCACCATTAAGGAGTCACGCATTTTCTGCTCGATCCTTCCCGAAGAACTGCTG
AACACGGAATGGACTCCAAAGTCAGGATCGTTGGCTGTGAACGTTCGCGCCATGTCAACTCTCTCGACTGACCTC
GCCCACCTCGTTGCTGACTCTATCCTATACCTCGAGGAGCCTAAGAAGCGTGCCGCTACCATCAAGCACTGGGTC
AAGATTGCGAACAAATGTCTAGAGTTGAACAACTACGACTCCCTCATGGCGATAATCTGCTCATTGAACTCGTCT
ATGATCTCTCGACTGAAGAAGACCTGGGACATCGTATCGCAGAAGACCAAGACTGTCCTCGAGCAGCTCTGCGGT
ATCGTGGATGTGTCTCGCAACTACGCAGTACTCCGTCAGCGCCTTCAGAACCACGTCCCTCCTTGCCTTCCATTT
GTCGGTACCTACCTGACCGACCTCACCTTCGTCGACCACGGCAACCAATCTCTCCGCACCCTCTCCACCCATGAC
AGTGAAATGACTGTCATCAACTTCGACAAGCACATGAAGACAGCCCGTATTATCAGCGAGCTCCAACGGTTCCAG
ATCCCCTACCGTCTGACCGAAGTCCCAGAGCTACAGGTCTGGATGCAGAATGAGTTTGTGCGCGTGCGCTCAAAC
GGCGAAATCACCACACAAACCTTCTACCGCCGCTCTCTGGTTCTCGAGCCTAGAGAAGCCTCCCGCAGCGCAAAC
AACCTTCAGTCCCAGTCCGAGCCCATGCCTTCCATGCTTGACAATGCCAAGGACAAGTTCGACTTCCTCTCATGG
ACCAACCATCCCAAGGCGAAGTCCGTCCCGACACACGGATAA
Transcript >Pro_DTO377G3_2|g1474.t1
ATGACCCCTCCGTTAACGCCACAAAACGCCCAGGACACAAACATGGATCAATTGGAAGCCCCGAGGCCTGTCTTT
CACAACTATCTGCGCGCCTTCTACCCTTTTCACCCGGCTGGCAATGTCTCTCCTTCGACCGTTACACTCCCGCTG
GACCAGGGAGATATCATTTTGGTACACTCCGTTCACACCAATGGCTGGGCCGATGGTACATTATTAGATTCTGGG
AATCGCGGCTGGTTACCCACGAATTACTGCGAGGCTTACGACCAATTACCCATGCGTCCTTTGTTGAAGGCCTTG
ACTGATTTCTGGGATATCATTCGAGGAAACTTCGGGTCATCACTGAAGGACTTTGGAAATCAAGACTTGATGAGA
GGCCCTATCGCTGGCGTCCGCTTTCTACTAGAAAAATCAGAATGTCTTACTCGAGAATCCGCTCTGGTAAGGCGA
TTTGAGGGACTACGCAGAATTCGAAAGGCTTTGCTATCTGACCTGTCTTCGCTGGTGAAAACTGCGAAAAAGTTC
CAGGAAATTGCAAACGGGCTCCCGTCAGAAGACGAGGTTGAGGCCATTCTGGATGAGATGCTTCTCAAGGCTTTC
AAGATTGTTACTAGAGGAGTTCGATTCCTCGACGTCTGGAACGAGGAGGTAGGCTTGGGTCGGACTATCGCCGAG
ATGGATGGGCCCAACGAAAGCTCAGGCCAGTATAGCATGCCACCGACTCCTGCATCCGAAACTTTCAACTTGGGC
GAGAACGAGGGACCTGATCGATCTGCGTCGCGAATGCTGGAATCACGAATGGACCATAGCCGGATGGATATGAGT
CGATCATCGATGCGCACGGAGATGGTTGATCCTAGACCGGCCTCCGTCGCTACCAAACGGGTTTCTGTATCCCAC
CGCATGTCAGTCTCCGGCCCTTCGACTGCCATCGTTGCCCAGAATCTGGCATCCGAACGCCTGGGAACAACATAT
GATGCATTCCTCGGCGTACTTGGCTCATTCCTCGGGTTCCATATGCAGTCCCGCTCCTCGATGGAGTTGGTTGTC
ACTACACAGCAGGCTGTCGAGGCATGCAAGCAATTGCTAAACGTCATTGAGGTAGTATGTGAGCATGGTACACAT
CGCAGCGCGTTTCTCGAACAGGCACGAGAGTTAATGTGGGAGAAGCTATCTGAGCTCGTTCACGCTGCACGCGAC
GTGTTTCGTCCCGCACAAATGCCAGAAGATGATCTATTTTTCATGGTAGATGAAGGAAAACGCCTTGTGGGTGCT
GCGACTGACTGTGTCCGAGCAGCTGGAAACTGTTTGGCCAAGGCTCGCCTGGTGCTTGAGCAAATTGGTGACCTT
GAGCTTGACCCTGAACACTTCGAAGAGGAAAGACAGGAATTGTCTAGCGTTGCCTCTCCACAAGATGAACCGCAG
ACTCCCGTAGAAGAAGAGCGACAGGAGATGTCACGTCTTCCCCCACCTCCTCTTCAGATCCCTAGCACACCTGCT
CTCACCGACGCTACAACACCTTCATCCTTTCAGTCTCTTCCTGCAAATTCCCCCGCCAACATCACCGCCATTTCT
TCTTTACCTAATTCTGCCATACTCCCCACCCACCTCGAGAACATCTCTTCCTTCTCCTCCACTGACAGTAACTAC
CGTGAAAGTCATCCCAAGTCTGATATGAGCGAATCATTCGGACGTGGAATTACAAGCAATGGCAGCAGCTTCACG
TATAATAGCCATGCACGTGATTCTGAGATGAGTGGCGTTTCCCAAACCTCGACTCGGGCTACCTCGCCTGATATT
GGGGGTAGCTTCCAGGGTAGCTTCAAGGTTCACTCGCTGAAGGAGAGTCTGAGCTACTCCACCCTCGCCGAGGAA
AATGAGGAGACTGAGGCCAACATCCTGGAGAAGACTTTCGCACACGAACTTATTTACAAGGAAGGTTCGGTGATG
GGCGGGAGTTTGCGTGCTCTTATTGAGAAGCTGACTGCTCATCAATCTACCCCCGATGCCATGTTTGTTTCAACC
TTCTACCTCACCTTCCGTCTGTTTGCTACGCCTCTTGAGTTTGCCGAGGCCCTCGCTGAACGCTTCGACTATATT
GGTGAGACACCCCACGCCGCCGGACCCGTCCGTCTGCGTGTATACAACATCTTCAAGGGCTGGCTCGAGTCGCAC
TGGCGCCACGACCGCGACAACACGGCCCTGGAGTTCATCGTCGACTTCGCAAGCACACGACTTATGGCGGACCTT
CCCACTGCTGGTATGAGGTTGCTTGATTTGGCCGGCAAGGTGTCCTCCGTTGGTGGTCCTCTTGTGCCTCGCCTG
ATATCTTCCATGGGCAAGACCAACACTTCCATTGCCCAATACATTCACCCCGATACTCCCTTACCCCCTCCCATC
CTTGGCAAGAAGGAGCACCACTTGCTCAAGCAATGGAAGAACGGCGAAGCCTCTATAACCATCCTTGACTTCGAC
CCACTTGAGCTCGCCCGCCAGCTCACCATTAAGGAGTCACGCATTTTCTGCTCGATCCTTCCCGAAGAACTGCTG
AACACGGAATGGACTCCAAAGTCAGGATCGTTGGCTGTGAACGTTCGCGCCATGTCAACTCTCTCGACTGACCTC
GCCCACCTCGTTGCTGACTCTATCCTATACCTCGAGGAGCCTAAGAAGCGTGCCGCTACCATCAAGCACTGGGTC
AAGATTGCGAACAAATGTCTAGAGTTGAACAACTACGACTCCCTCATGGCGATAATCTGCTCATTGAACTCGTCT
ATGATCTCTCGACTGAAGAAGACCTGGGACATCGTATCGCAGAAGACCAAGACTGTCCTCGAGCAGCTCTGCGGT
ATCGTGGATGTGTCTCGCAACTACGCAGTACTCCGTCAGCGCCTTCAGAACCACGTCCCTCCTTGCCTTCCATTT
GTCGGTACCTACCTGACCGACCTCACCTTCGTCGACCACGGCAACCAATCTCTCCGCACCCTCTCCACCCATGAC
AGTGAAATGACTGTCATCAACTTCGACAAGCACATGAAGACAGCCCGTATTATCAGCGAGCTCCAACGGTTCCAG
ATCCCCTACCGTCTGACCGAAGTCCCAGAGCTACAGGTCTGGATGCAGAATGAGTTTGTGCGCGTGCGCTCAAAC
GGCGAAATCACCACACAAACCTTCTACCGCCGCTCTCTGGTTCTCGAGCCTAGAGAAGCCTCCCGCAGCGCAAAC
AACCTTCAGTCCCAGTCCGAGCCCATGCCTTCCATGCTTGACAATGCCAAGGACAAGTTCGACTTCCTCTCATGG
ACCAACCATCCCAAGGCGAAGTCCGTCCCGACACACGGATAA
Gene >Pro_DTO377G3_2|g1474.t1
ATGACCCCTCCGTTAACGCCACAAAACGCCCAGGACACAAACATGGATCAATTGGAAGCCCCGAGGCCTGTCTTT
CACAACTATCTGCGCGCCTTCTACCCTTTTCACCCGGCTGGCAATGTCTCTCCTTCGACCGTTACACTCCCGCTG
GACCAGGGAGATATCATTTTGGTACACTCCGTTCACACCAATGGCTGGGCCGATGGTACATTATTAGATTCTGGG
AATCGCGGCTGGTTACCCACGAATTACTGCGAGGCTTACGACCAATTACCCATGCGTCCTTTGTTGAAGGCCTTG
ACTGATTTCTGGGATATCATTCGAGGAAACTTCGGGTCATCACTGAAGGACTTTGGAAATCAAGACTTGATGAGA
GGCCCTATCGCTGGCGTCCGCTTTCTACTAGTAAGTATGAATTAGAACCGAGAAACAATTACGGGGCTTATCATT
CCACAGGAAAAATCAGAATGTCTTACTCGAGAATCCGCTCTGGTAAGGCGATTTGAGGGACTACGCAGAATTCGA
AAGGCTTTGCTATCTGACCTGTCTTCGCTGGTGAAAACTGCGAAAAAGTTCCAGGAAATTGCAAACGGGCTCCCG
TCAGAAGACGAGGTTGAGGCCATTCTGGATGAGATGCTTCTCAAGGCTTTCAAGATTGTTACTAGAGGAGTTCGA
TTCCTCGACGTCTGGAACGAGGAGGTAGGCTTGGGTCGGACTATCGCCGAGATGGATGGGCCCAACGAAAGCTCA
GGCCAGTATAGCATGCCACCGACTCCTGCATCCGAAACTTTCAACTTGGGCGAGAACGAGGGACCTGATCGATCT
GCGTCGCGAATGCTGGAATCACGAATGGACCATAGCCGGATGGATATGAGTCGATCATCGATGCGCACGGAGATG
GTTGATCCTAGACCGGCCTCCGTCGCTACCAAACGGGTTTCTGTATCCCACCGCATGTCAGTCTCCGGCCCTTCG
ACTGCCATCGTTGCCCAGAATCTGGCATCCGAACGCCTGGGAACAACATATGATGCATTCCTCGGCGTACTTGGC
TCATTCCTCGGGTTCCATATGCAGTCCCGCTCCTCGATGGAGTTGGTTGTCACTACACAGCAGGCTGTCGAGGCA
TGCAAGCAATTGCTAAACGTCATTGAGGTAGTATGTGAGCATGGTACACATCGCAGCGCGTTTCTCGAACAGGCA
CGAGAGTTAATGTGGGAGAAGCTATCTGAGCTCGTTCACGCTGCACGCGACGTGTTTCGTCCCGCACAAATGCCA
GAAGATGATCTATTTTTCATGGTAGATGAAGGAAAACGCCTTGTGGGTGCTGCGACTGACTGTGTCCGAGCAGCT
GGAAACTGTTTGGCCAAGGCTCGCCTGGTGCTTGAGCAAATTGGTGACCTTGAGCTTGACCCTGAACACTTCGAA
GAGGAAAGACAGGAATTGTCTAGCGTTGCCTCTCCACAAGATGAACCGCAGACTCCCGTAGAAGAAGAGCGACAG
GAGATGTCACGTCTTCCCCCACCTCCTCTTCAGATCCCTAGCACACCTGCTCTCACCGACGCTACAACACCTTCA
TCCTTTCAGTCTCTTCCTGCAAATTCCCCCGCCAACATCACCGCCATTTCTTCTTTACCTAATTCTGCCATACTC
CCCACCCACCTCGAGAACATCTCTTCCTTCTCCTCCACTGACAGTAACTACCGTGAAAGTCATCCCAAGTCTGAT
ATGAGCGAATCATTCGGACGTGGAATTACAAGCAATGGCAGCAGCTTCACGTATAATAGCCATGCACGTGATTCT
GAGATGAGTGGCGTTTCCCAAACCTCGACTCGGGCTACCTCGCCTGATATTGGGGGTAGCTTCCAGGGTAGCTTC
AAGGTTCACTCGCTGAAGGAGAGTCTGAGCTACTCCACCCTCGCCGAGGAAAATGAGGAGACTGAGGCCAACATC
CTGGAGAAGACTTTCGCACACGAACTTATTTACAAGGAAGGTTCGGTGATGGGCGGGAGTTTGCGTGCTCTTATT
GAGAAGCTGACTGCTCATCAATCTACCCCCGATGCCATGTTTGTTTCAACCTTCTACCTCACCTTCCGTCTGTTT
GCTACGCCTCTTGAGTTTGCCGAGGCCCTCGCTGAACGCTTCGACTATATTGGTGAGACACCCCACGCCGCCGGA
CCCGTCCGTCTGCGTGTATACAACATCTTCAAGGGCTGGCTCGAGTCGCACTGGCGCCACGACCGCGACAACACG
GCCCTGGAGTTCATCGTCGACTTCGCAAGCACACGACTTATGGCGGACCTTCCCACTGCTGGTATGAGGTTGCTT
GATTTGGCCGGCAAGGTGTCCTCCGTTGGTGGTCCTCTTGTGCCTCGCCTGATATCTTCCATGGGCAAGACCAAC
ACTTCCATTGCCCAATACATTCACCCCGATACTCCCTTACCCCCTCCCATCCTTGGCAAGAAGGAGCACCACTTG
CTCAAGCAATGGAAGAACGGCGAAGCCTCTATAACCATCCTTGACTTCGACCCACTTGAGCTCGCCCGCCAGCTC
ACCATTAAGGAGTCACGCATTTTCTGCTCGATCCTTCCCGAAGAACTGCTGAACACGGAATGGACTCCAAAGTCA
GGATCGTTGGCTGTGAACGTTCGCGCCATGTCAACTCTCTCGACTGACCTCGCCCACCTCGTTGCTGACTCTATC
CTATACCTCGAGGAGCCTAAGAAGCGTGCCGCTACCATCAAGCACTGGGTCAAGATTGCGAACAAATGTCTAGAG
TTGAACAACTACGACTCCCTCATGGCGATAATCTGCTCATTGAACTCGTCTATGATCTCTCGACTGAAGAAGACC
TGGGACATCGTATCGCAGAAGACCAAGACTGTCCTCGAGCAGCTCTGCGGTATCGTGGATGTGTCTCGCAACTAC
GCAGTACTCCGTCAGCGCCTTCAGAACCACGTCCCTCCTTGCCTTCCATTTGTCGGTACCTACCTGACCGACCTC
ACCTTCGTCGACCACGGCAACCAATCTCTCCGCACCCTCTCCACCCATGACAGTGAAATGACTGTCATCAACTTC
GACAAGCACATGAAGACAGCCCGTATTATCAGCGAGCTCCAACGGTTCCAGATCCCCTACCGTCTGACCGAAGTC
CCAGAGCTACAGGTCTGGATGCAGAATGAGTTTGTGCGCGTGCGCTCAAACGGCGAAATCACCACACAAACCTTC
TACCGCCGCTCTCTGGTTCTCGAGCCTAGAGAAGCCTCCCGCAGCGCAAACAACCTTCAGTCCCAGTCCGAGCCC
ATGCCTTCCATGCTTGACAATGCCAAGGACAAGTTCGACTTCCTCTCATGGACCAACCATCCCAAGGCGAAGTCC
GTCCCGACACACGGATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail