Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g1464.t1
Gene name
Locationscaffold_02:15238..17590
Strand-
Gene length (bp)2352
Transcript length (bp)2220
Coding sequence length (bp)2220
Protein length (aa) 740

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02040 ArsB Arsenical pump membrane protein 4.3E-06 118 261

GO

GO Term Description Terminal node
GO:0015105 arsenite transmembrane transporter activity Yes
GO:0015700 arsenite transport Yes
GO:0016021 integral component of membrane Yes
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0015698 inorganic anion transport No
GO:0008509 anion transmembrane transporter activity No
GO:0005215 transporter activity No
GO:0051179 localization No
GO:0031224 intrinsic component of membrane No
GO:0022857 transmembrane transporter activity No
GO:0006811 ion transport No
GO:0006810 transport No
GO:0015318 inorganic molecular entity transmembrane transporter activity No
GO:0044425 membrane part No
GO:0015075 ion transmembrane transporter activity No
GO:0015103 inorganic anion transmembrane transporter activity No
GO:0006820 anion transport No
GO:0051234 establishment of localization No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 49 0.5

Transmembrane Domains

Domain # Start End Length
1 15 37 22
2 77 99 22
3 121 143 22
4 156 178 22
5 239 261 22
6 324 346 22
7 351 373 22
8 564 586 22
9 606 628 22
10 666 688 22
11 708 730 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g1464.t1
MDDELDTSEIKSWRSIITLIIFVITNIIVLFPFHIPIYVPRWLTNGILDLLSVIRIIPHRTRPRYNQKQPIFVKL
CFPLNFITAPLTADLFLLAILAIGRKEVHDGIVGADNINPIDIMVFFLTLAYIAISIDASGLIRYLAFKVLQKAG
KVGHRLFFYLFLFFFGLGSFIGNDPIILSGTAFLAYMTRVSSNIVHPRAWIHSQFAVANIASAILVSSNPTNLVL
AGAFKIKFIVYTANMIVPVVVTAIILFPFLLYIIFADESLIPLSITMHELSEDQKKKAPVNPNIPHARGTAEEKE
EADDKEGKQLSLEEIMNPFLDRKGASFGGLIMATTLITLLAINASGKEHPVFWVTLPAAFVMFCWDLVFGWLHRQ
ETREISAKGRREVEQARTEREMRERIALPEKMDPGTLTSDQADQYDASGLHHRSEHTDYDISLKSTDSDIASKDF
DPECGTPLSVSVPVDKEKFPELQLPGGVVMDSKQLARASSPQALDSRQTTDSTIYNGKPGYTQTLDSPQTTESTI
YEENPGYPYHQDSAPCSLVSLATDLYKWSQETFPTTTVVVSHMPFALVPFAFTMFILVQALVTKGWVPVFAYGWD
HWVEKTGTIGSIGGMGFLSVILCNFAGTNIGTTILLSRVIQAWQKIHEASGIPISDRTWWATVYSMALGVNYGAF
STAFSASLAGLLWRDILARKHIRVGSLEFARVNLPIIAISMVVGCAVLAGEVYIVRSDKPYVPA*
Coding >Pro_DTO377G3_2|g1464.t1
ATGGACGACGAACTGGATACTTCGGAAATCAAAAGTTGGCGATCAATCATCACCCTAATTATTTTTGTTATAACT
AATATAATTGTCCTTTTCCCATTTCACATCCCTATATACGTGCCTCGATGGCTCACAAACGGGATTCTGGACCTA
TTAAGTGTCATACGCATAATACCACACCGGACTCGCCCTCGATACAATCAAAAGCAACCCATTTTCGTGAAACTC
TGCTTTCCATTGAACTTCATCACGGCACCTTTAACAGCGGACCTATTCCTTCTCGCGATTCTGGCAATCGGCCGA
AAAGAGGTACACGATGGAATAGTCGGCGCAGACAACATCAATCCCATTGATATCATGGTCTTCTTCCTCACACTC
GCCTACATTGCCATCTCGATTGACGCCTCCGGCCTCATCAGATACCTGGCCTTCAAGGTCCTCCAAAAAGCAGGC
AAGGTCGGCCACCGACTCTTCTTCTACCTGTTCCTTTTCTTTTTCGGACTAGGCAGCTTCATCGGAAACGACCCG
ATCATCCTATCCGGCACGGCGTTCCTCGCATACATGACCCGCGTATCCAGCAATATCGTCCACCCCCGAGCCTGG
ATCCACAGCCAGTTCGCCGTAGCCAACATCGCCTCTGCGATTCTCGTCTCCTCGAACCCCACCAACCTGGTCCTT
GCCGGCGCTTTCAAGATCAAGTTCATCGTCTACACGGCCAACATGATCGTTCCCGTAGTCGTCACGGCGATTATC
CTGTTCCCGTTCCTGCTATATATCATTTTCGCAGACGAATCCCTCATTCCTCTCTCTATCACAATGCACGAGCTG
TCCGAGGACCAAAAGAAAAAAGCACCTGTGAATCCCAACATCCCTCATGCCAGAGGAACCGCCGAGGAGAAAGAG
GAAGCTGATGATAAGGAGGGAAAGCAACTCTCACTAGAAGAGATCATGAACCCATTCTTAGATAGGAAGGGTGCA
TCTTTTGGGGGTTTGATTATGGCCACCACGCTTATCACCCTCCTGGCAATCAATGCATCAGGCAAAGAGCATCCC
GTTTTCTGGGTCACATTACCCGCTGCTTTCGTTATGTTCTGCTGGGATCTCGTCTTCGGCTGGCTCCATCGCCAA
GAAACCCGTGAGATTTCCGCGAAGGGTCGACGGGAGGTTGAGCAAGCACGGACAGAGCGAGAAATGCGCGAACGC
ATAGCGCTGCCGGAAAAGATGGATCCAGGGACGTTGACATCGGACCAGGCGGATCAATATGATGCATCAGGCCTG
CACCACCGCAGTGAGCATACAGACTACGACATCTCGCTCAAGAGCACCGATAGTGATATCGCCTCGAAGGATTTC
GATCCAGAATGCGGAACGCCCTTGTCAGTCTCTGTGCCCGTTGACAAGGAAAAGTTCCCAGAACTACAGCTACCA
GGCGGTGTTGTGATGGACAGCAAACAACTAGCTCGTGCAAGTTCTCCCCAGGCACTGGACTCGCGACAAACCACC
GACTCGACGATATACAATGGGAAACCGGGATATACCCAGACACTGGACTCGCCACAAACCACCGAATCAACGATA
TACGAGGAGAACCCAGGATATCCATATCACCAAGACAGCGCCCCATGCAGCCTGGTATCACTCGCTACCGATCTC
TACAAATGGTCCCAGGAGACATTCCCCACGACGACAGTCGTAGTCTCCCACATGCCATTCGCACTAGTACCCTTC
GCGTTCACGATGTTCATCCTGGTACAGGCGCTCGTCACCAAGGGCTGGGTGCCTGTTTTCGCGTACGGCTGGGAC
CACTGGGTCGAAAAGACCGGGACAATCGGCAGTATCGGTGGAATGGGCTTCCTATCTGTGATTCTGTGCAATTTC
GCCGGAACAAATATCGGCACCACGATCCTCCTCTCGCGCGTCATCCAGGCATGGCAGAAGATCCACGAAGCCAGC
GGAATCCCTATCAGCGATCGCACATGGTGGGCTACCGTTTACAGCATGGCTCTCGGTGTCAATTATGGTGCTTTC
AGTACTGCGTTTAGTGCGTCGCTGGCTGGGCTGCTGTGGCGGGATATTTTGGCGAGGAAGCATATCCGTGTTGGG
AGTTTGGAATTTGCCCGTGTGAATCTTCCTATTATTGCTATTTCGATGGTGGTTGGGTGTGCGGTTCTCGCTGGG
GAGGTTTATATTGTTAGGAGTGATAAGCCATATGTACCGGCTTGA
Transcript >Pro_DTO377G3_2|g1464.t1
ATGGACGACGAACTGGATACTTCGGAAATCAAAAGTTGGCGATCAATCATCACCCTAATTATTTTTGTTATAACT
AATATAATTGTCCTTTTCCCATTTCACATCCCTATATACGTGCCTCGATGGCTCACAAACGGGATTCTGGACCTA
TTAAGTGTCATACGCATAATACCACACCGGACTCGCCCTCGATACAATCAAAAGCAACCCATTTTCGTGAAACTC
TGCTTTCCATTGAACTTCATCACGGCACCTTTAACAGCGGACCTATTCCTTCTCGCGATTCTGGCAATCGGCCGA
AAAGAGGTACACGATGGAATAGTCGGCGCAGACAACATCAATCCCATTGATATCATGGTCTTCTTCCTCACACTC
GCCTACATTGCCATCTCGATTGACGCCTCCGGCCTCATCAGATACCTGGCCTTCAAGGTCCTCCAAAAAGCAGGC
AAGGTCGGCCACCGACTCTTCTTCTACCTGTTCCTTTTCTTTTTCGGACTAGGCAGCTTCATCGGAAACGACCCG
ATCATCCTATCCGGCACGGCGTTCCTCGCATACATGACCCGCGTATCCAGCAATATCGTCCACCCCCGAGCCTGG
ATCCACAGCCAGTTCGCCGTAGCCAACATCGCCTCTGCGATTCTCGTCTCCTCGAACCCCACCAACCTGGTCCTT
GCCGGCGCTTTCAAGATCAAGTTCATCGTCTACACGGCCAACATGATCGTTCCCGTAGTCGTCACGGCGATTATC
CTGTTCCCGTTCCTGCTATATATCATTTTCGCAGACGAATCCCTCATTCCTCTCTCTATCACAATGCACGAGCTG
TCCGAGGACCAAAAGAAAAAAGCACCTGTGAATCCCAACATCCCTCATGCCAGAGGAACCGCCGAGGAGAAAGAG
GAAGCTGATGATAAGGAGGGAAAGCAACTCTCACTAGAAGAGATCATGAACCCATTCTTAGATAGGAAGGGTGCA
TCTTTTGGGGGTTTGATTATGGCCACCACGCTTATCACCCTCCTGGCAATCAATGCATCAGGCAAAGAGCATCCC
GTTTTCTGGGTCACATTACCCGCTGCTTTCGTTATGTTCTGCTGGGATCTCGTCTTCGGCTGGCTCCATCGCCAA
GAAACCCGTGAGATTTCCGCGAAGGGTCGACGGGAGGTTGAGCAAGCACGGACAGAGCGAGAAATGCGCGAACGC
ATAGCGCTGCCGGAAAAGATGGATCCAGGGACGTTGACATCGGACCAGGCGGATCAATATGATGCATCAGGCCTG
CACCACCGCAGTGAGCATACAGACTACGACATCTCGCTCAAGAGCACCGATAGTGATATCGCCTCGAAGGATTTC
GATCCAGAATGCGGAACGCCCTTGTCAGTCTCTGTGCCCGTTGACAAGGAAAAGTTCCCAGAACTACAGCTACCA
GGCGGTGTTGTGATGGACAGCAAACAACTAGCTCGTGCAAGTTCTCCCCAGGCACTGGACTCGCGACAAACCACC
GACTCGACGATATACAATGGGAAACCGGGATATACCCAGACACTGGACTCGCCACAAACCACCGAATCAACGATA
TACGAGGAGAACCCAGGATATCCATATCACCAAGACAGCGCCCCATGCAGCCTGGTATCACTCGCTACCGATCTC
TACAAATGGTCCCAGGAGACATTCCCCACGACGACAGTCGTAGTCTCCCACATGCCATTCGCACTAGTACCCTTC
GCGTTCACGATGTTCATCCTGGTACAGGCGCTCGTCACCAAGGGCTGGGTGCCTGTTTTCGCGTACGGCTGGGAC
CACTGGGTCGAAAAGACCGGGACAATCGGCAGTATCGGTGGAATGGGCTTCCTATCTGTGATTCTGTGCAATTTC
GCCGGAACAAATATCGGCACCACGATCCTCCTCTCGCGCGTCATCCAGGCATGGCAGAAGATCCACGAAGCCAGC
GGAATCCCTATCAGCGATCGCACATGGTGGGCTACCGTTTACAGCATGGCTCTCGGTGTCAATTATGGTGCTTTC
AGTACTGCGTTTAGTGCGTCGCTGGCTGGGCTGCTGTGGCGGGATATTTTGGCGAGGAAGCATATCCGTGTTGGG
AGTTTGGAATTTGCCCGTGTGAATCTTCCTATTATTGCTATTTCGATGGTGGTTGGGTGTGCGGTTCTCGCTGGG
GAGGTTTATATTGTTAGGAGTGATAAGCCATATGTACCGGCTTGA
Gene >Pro_DTO377G3_2|g1464.t1
ATGGACGACGAACTGGATACTTCGGAAATCAAAAGTTGGCGATCAATCATCACCCTAATTATTTTTGTTATAACT
AGTAAGTCTGGTTAGGCCTGATGTGAGACGAAGACTTACTTTTGTTTCTTGCGATGCAGATATAATTGTCCTTTT
CCCATTTCACATCCCTATATACGTGCCTCGATGGCTCACAAACGGGATTCTGGACCTATTAAGTGTCATACGCAT
AATACCACACCGGACTCGCCCTCGATACAATCAAAAGCAACCCATTTTCGTGAAACTCTGCTTTCCATTGAACTT
CATCACGGCACCTTTAACAGCGGACCTATTCCTTCTCGCGATTCTGGCAATCGGCCGAAAAGAGGTACACGATGG
AATAGTCGGCGCAGACAACATCAATCCCATTGATATCATGGTCTTCTTCCTCACACTCGCCTACATTGCCATCTC
GATTGACGCCTCCGGCCTCATCAGATACCTGGCCTTCAAGGTCCTCCAAAAAGCAGGCAAGGTCGGCCACCGACT
CTTCTTCTACCTGTTCCTTTTCTTTTTCGGACTAGGCAGCTTCATCGGAAACGACCCGATCATCCTATCCGGCAC
GGCGTTCCTCGCATACATGACCCGCGTATCCAGCAATATCGTCCACCCCCGAGCCTGGATCCACAGCCAGTTCGC
CGTAGCCAACATCGCCTCTGCGATTCTCGTCTCCTCGAACCCCACCAACCTGGTCCTTGCCGGCGCTTTCAAGAT
CAAGTTCATCGTCTACACGGCCAACATGATCGTTCCCGTAGTCGTCACGGCGATTATCCTGTTCCCGTTCCTGCT
ATATATCATTTTCGCAGACGAATCCCTCATTCCTCTCTCTATCACAATGCACGAGCTGTCCGAGGACCAAAAGAA
AAAAGCACCTGTGAATCCCAACATCCCTCATGCCAGAGGAACCGCCGAGGAGAAAGAGGAAGCTGATGATAAGGA
GGGAAAGCAACTCTCACTAGAAGAGATCATGAACCCATTCTTAGATAGGAAGGGTGCATCTTTTGGGGGTTTGAT
TATGGCCACCACGCTTATCACCCTCCTGGCAATCAATGCATCAGGCAAAGAGCATCCCGTTTTCTGGGTCACATT
ACCCGCTGCTTTCGTTATGTTCTGCTGGGATCTCGTCTTCGGCTGGCTCCATCGCCAAGAAACCCGTGAGATTTC
CGCGAAGGGTCGACGGGAGGTTGAGCAAGCACGGACAGAGCGAGAAATGCGCGAACGCATAGCGCTGCCGGAAAA
GATGGATCCAGGGACGTTGACATCGGACCAGGCGGATCAATATGATGCATCAGGCCTGCACCACCGCAGTGAGCA
TACAGACTACGACATCTCGCTCAAGAGCACCGATAGTGATATCGCCTCGAAGGATTTCGATCCAGAATGCGGAAC
GCCCTTGTCAGTCTCTGTGCCCGTTGACAAGGAAAAGTTCCCAGAACTACAGCTACCAGGCGGTGTTGTGATGGA
CAGCAAACAACTAGCTCGTGCAAGTTCTCCCCAGGCACTGGACTCGCGACAAACCACCGACTCGACGATATACAA
TGGGAAACCGGGATATACCCAGACACTGGACTCGCCACAAACCACCGAATCAACGATATACGAGGAGAACCCAGG
ATATCCATATCACCAAGACAGCGCCCCATGCAGCCTGGTATCACTCGCTACCGATCTCTACAAATGGTCCCAGGA
GACATTCCCCACGACGACAGTCGTAGTCTCCCACATGCCATTCGCACTAGTACCCTTCGCGTTCACGATGTTCAT
CCTGGTACAGGCGCTCGTCACCAAGGGCTGGGTGCCTGTTTTCGCGTACGGCTGGGACCACTGGGTCGAAAAGAC
CGGGACAATCGGCAGTATCGGTGGAATGGGCTTCCTATCTGTGATTCTGTGCAATGTAAGGATTGGGACAACAGA
AAATAGACTTAGCCTCTTTTTCTTCCGCTAACTCGTCATCTTCTAATCATCCAGTTCGCCGGAACAAATATCGGC
ACCACGATCCTCCTCTCGCGCGTCATCCAGGCATGGCAGAAGATCCACGAAGCCAGCGGAATCCCTATCAGCGAT
CGCACATGGTGGGCTACCGTTTACAGCATGGCTCTCGGTGTCAATTATGGTGCTTTCAGTACTGCGTTTAGTGCG
TCGCTGGCTGGGCTGCTGTGGCGGGATATTTTGGCGAGGAAGCATATCCGTGTTGGGAGTTTGGAATTTGCCCGT
GTGAATCTTCCTATTATTGCTATTTCGATGGTGGTTGGGTGTGCGGTTCTCGCTGGGGAGGTTTATATTGTTAGG
AGTGATAAGCCATATGTACCGGCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail