Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g1457.t1
Gene name
Locationscaffold_01:3840520..3842048
Strand+
Gene length (bp)1528
Transcript length (bp)1239
Coding sequence length (bp)1239
Protein length (aa) 413

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 25 0.5

Transmembrane Domains

Domain # Start End Length
1 21 40 19
2 50 72 22
3 169 191 22
4 195 217 22
5 272 294 22
6 299 316 17

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 2.68 0.58 4.78
5d_25C Five days - 25 degrees Celsius 2.69 0.57 4.82
7d_25C Seven days - 25 degrees Celsius 1.93 0.27 3.59
10d_25C Ten days - 25 degrees Celsius 0.96 0.00 1.95
7d_15C Seven days - 15 degrees Celsius 1.74 0.00 3.51
7d_30C Seven days - 30 degrees Celsius 4.28 1.18 7.38

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.995129 no
3d_25C 7d_25C 0.572329 no
3d_25C 7d_15C 0.471370 no
3d_25C 7d_30C 0.298711 no
3d_25C 10d_25C 0.058634 no
5d_25C 7d_25C 0.557696 no
5d_25C 7d_15C 0.457726 no
5d_25C 7d_30C 0.296946 no
5d_25C 10d_25C 0.055151 no
7d_25C 7d_15C 0.898780 no
7d_25C 7d_30C 0.080462 no
7d_25C 10d_25C 0.237381 no
7d_15C 7d_30C 0.090912 no
7d_15C 10d_25C 0.376975 no
7d_30C 10d_25C 0.010083 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g1457.t1
MGSNGAKFLWCNLGATCMTQWVHPSDVFSVLLILGGDIVARALAQLAGSGLTPVTFSFGWVAYSVSALVSAVGEN
KLMPQNVDCKCKVINGKSGYSRDNSSWVIGRIVRDFDTWSGTATKEKTKKLLGEKWEELKSLDKAAEEPTRAGLV
VTIYEPSATPKAGLAKRDLIFWSGLLIMLLQLGIAAIPCGLFGDWGILIITACGNVLAIVTGVLPQWKKEKWACR
PKSKYSYILTRGNGAQHAIVILGNGHGLNLEDLASGQSNVESSTNTLTRAVLLALSIFWVLLLIAAAGLRGNTWF
LLAIGGIGIVQNVFVAGRSMKPENYGIHLDYVGVFGKTKVMDTLLDVEQKYPGIGRSMRDEFFPGKLPLAGVRAW
EQIEQSTESEPRAKAPRESQDDSEETQAEERQVEERI*
Coding >Pro_DTO377G3_2|g1457.t1
ATGGGTTCTAACGGTGCGAAGTTTCTGTGGTGTAATCTCGGCGCTACATGCATGACTCAATGGGTCCACCCTAGC
GATGTATTTTCCGTACTACTGATCCTGGGCGGTGATATTGTTGCTCGCGCGCTGGCACAACTTGCAGGAAGTGGC
CTGACGCCAGTCACATTCTCGTTTGGATGGGTTGCGTACTCCGTCTCGGCGCTTGTATCTGCCGTTGGCGAAAAC
AAACTCATGCCACAGAACGTGGATTGCAAATGCAAAGTCATCAATGGCAAGAGTGGATACAGTAGAGACAACTCG
AGCTGGGTTATAGGCCGTATTGTGCGCGATTTTGATACATGGAGCGGCACTGCTACCAAAGAGAAGACCAAAAAA
CTTCTGGGAGAAAAGTGGGAGGAACTCAAATCCCTCGATAAGGCTGCAGAGGAGCCAACAAGAGCTGGTCTTGTT
GTTACTATCTACGAGCCGAGTGCGACACCAAAGGCCGGCCTAGCTAAACGCGATCTTATTTTTTGGAGCGGCTTG
CTCATCATGTTATTGCAATTGGGAATTGCGGCTATACCATGTGGACTTTTCGGCGATTGGGGCATTTTGATAATT
ACGGCATGCGGCAATGTTCTTGCCATCGTGACTGGAGTTCTCCCACAATGGAAGAAGGAAAAGTGGGCGTGCCGG
CCTAAGTCCAAGTATTCCTATATTCTCACTCGAGGTAACGGTGCGCAACATGCCATCGTTATTCTTGGTAATGGA
CATGGCTTGAACCTTGAGGATTTGGCATCTGGACAGAGCAATGTTGAATCCTCTACTAATACCTTGACCCGAGCT
GTTCTCCTCGCCCTCTCTATATTCTGGGTACTTCTTCTCATCGCCGCAGCAGGTCTTAGGGGAAACACTTGGTTT
CTTCTCGCCATCGGCGGTATTGGCATTGTTCAGAATGTTTTCGTCGCTGGTCGAAGCATGAAGCCGGAGAATTAT
GGCATTCATCTAGATTATGTCGGGGTCTTCGGTAAAACGAAAGTGATGGATACACTCTTGGATGTTGAACAGAAG
TATCCAGGCATAGGTCGGAGCATGCGTGACGAGTTCTTTCCCGGAAAGCTTCCTCTAGCCGGAGTTCGAGCGTGG
GAACAGATCGAACAATCCACTGAATCTGAGCCTCGAGCGAAAGCGCCTCGGGAGTCTCAAGATGACTCTGAAGAA
ACTCAAGCTGAAGAGCGTCAAGTTGAAGAGCGGATCTAA
Transcript >Pro_DTO377G3_2|g1457.t1
ATGGGTTCTAACGGTGCGAAGTTTCTGTGGTGTAATCTCGGCGCTACATGCATGACTCAATGGGTCCACCCTAGC
GATGTATTTTCCGTACTACTGATCCTGGGCGGTGATATTGTTGCTCGCGCGCTGGCACAACTTGCAGGAAGTGGC
CTGACGCCAGTCACATTCTCGTTTGGATGGGTTGCGTACTCCGTCTCGGCGCTTGTATCTGCCGTTGGCGAAAAC
AAACTCATGCCACAGAACGTGGATTGCAAATGCAAAGTCATCAATGGCAAGAGTGGATACAGTAGAGACAACTCG
AGCTGGGTTATAGGCCGTATTGTGCGCGATTTTGATACATGGAGCGGCACTGCTACCAAAGAGAAGACCAAAAAA
CTTCTGGGAGAAAAGTGGGAGGAACTCAAATCCCTCGATAAGGCTGCAGAGGAGCCAACAAGAGCTGGTCTTGTT
GTTACTATCTACGAGCCGAGTGCGACACCAAAGGCCGGCCTAGCTAAACGCGATCTTATTTTTTGGAGCGGCTTG
CTCATCATGTTATTGCAATTGGGAATTGCGGCTATACCATGTGGACTTTTCGGCGATTGGGGCATTTTGATAATT
ACGGCATGCGGCAATGTTCTTGCCATCGTGACTGGAGTTCTCCCACAATGGAAGAAGGAAAAGTGGGCGTGCCGG
CCTAAGTCCAAGTATTCCTATATTCTCACTCGAGGTAACGGTGCGCAACATGCCATCGTTATTCTTGGTAATGGA
CATGGCTTGAACCTTGAGGATTTGGCATCTGGACAGAGCAATGTTGAATCCTCTACTAATACCTTGACCCGAGCT
GTTCTCCTCGCCCTCTCTATATTCTGGGTACTTCTTCTCATCGCCGCAGCAGGTCTTAGGGGAAACACTTGGTTT
CTTCTCGCCATCGGCGGTATTGGCATTGTTCAGAATGTTTTCGTCGCTGGTCGAAGCATGAAGCCGGAGAATTAT
GGCATTCATCTAGATTATGTCGGGGTCTTCGGTAAAACGAAAGTGATGGATACACTCTTGGATGTTGAACAGAAG
TATCCAGGCATAGGTCGGAGCATGCGTGACGAGTTCTTTCCCGGAAAGCTTCCTCTAGCCGGAGTTCGAGCGTGG
GAACAGATCGAACAATCCACTGAATCTGAGCCTCGAGCGAAAGCGCCTCGGGAGTCTCAAGATGACTCTGAAGAA
ACTCAAGCTGAAGAGCGTCAAGTTGAAGAGCGGATCTAA
Gene >Pro_DTO377G3_2|g1457.t1
ATGGGTTCTAACGGTGCGAAGTTTCTGTGGTGTAATCTCGGCGCTACATGCATGTAAGTACCCAATTTGTCAACA
GGGCCTGTGCCTGGCCAGGACTGTTCGTACCCCCACCACATCCTCCTGGATTTCGACGTTCAACGGACATTATAT
TCCTCATTACGCAATTTTCATTTGAACACAATTCTTCCTTCTTCGAGGAAGAAATCATGGCGCCCTTTCTCGCTA
CCTTACTATCCCGTGAACCTCGATTTGATCCGACTGTATCCTCTAACGAATTCAGGACTCAATGGGTCCACCCTA
GCGATGTATTTTCCGTACTACTGATCCTGGGCGGTGATATTGTTGCTCGCGCGCTGGCACAACTTGCAGGAAGTG
GCCTGACGCCAGTCACATTCTCGTTTGGTATGGCATCTTTAAGCCCTATTCTAACGAAGATTCCATGCTAAGTCG
ATGTACTCGAATAGGATGGGTTGCGTACTCCGTCTCGGCGCTTGTATCTGCCGTTGGCGAAAACAAACTCATGCC
ACAGAACGTGGATTGCAAATGCAAAGTCATCAATGGCAAGAGTGGATACAGTAGAGACAACTCGAGCTGGGTTAT
AGGCCGTATTGTGCGCGATTTTGATACATGGAGCGGCACTGCTACCAAAGAGAAGACCAAAAAACTTCTGGGAGA
AAAGTGGGAGGAACTCAAATCCCTCGATAAGGCTGCAGAGGAGCCAACAAGAGCTGGTCTTGTTGTTACTATCTA
CGAGCCGAGTGCGACACCAAAGGCCGGCCTAGCTAAACGCGATCTTATTTTTTGGAGCGGCTTGCTCATCATGTT
ATTGCAATTGGGAATTGCGGCTATACCATGTGGACTTTTCGGCGATTGGGGCATTTTGATAATTACGGCATGCGG
CAATGTTCTTGCCATCGTGACTGGAGTTCTCCCACAATGGAAGAAGGAAAAGTGGGCGTGCCGGCCTAAGTCCAA
GTATTCCTATATTCTCACTCGAGGTAACGGTGCGCAACATGCCATCGTTATTCTTGGTAATGGACATGGCTTGAA
CCTTGAGGATTTGGCATCTGGACAGAGCAATGTTGAATCCTCTACTAATACCTTGACCCGAGCTGTTCTCCTCGC
CCTCTCTATATTCTGGGTACTTCTTCTCATCGCCGCAGCAGGTCTTAGGGGAAACACTTGGTTTCTTCTCGCCAT
CGGCGGTATTGGCATTGTTCAGAATGTTTTCGTCGCTGGTCGAAGCATGAAGCCGGAGAATTATGGCATTCATCT
AGATTATGTCGGGGTCTTCGGTAAAACGAAAGTGATGGATACACTCTTGGATGTTGAACAGAAGTATCCAGGCAT
AGGTCGGAGCATGCGTGACGAGTTCTTTCCCGGAAAGCTTCCTCTAGCCGGAGTTCGAGCGTGGGAACAGATCGA
ACAATCCACTGAATCTGAGCCTCGAGCGAAAGCGCCTCGGGAGTCTCAAGATGACTCTGAAGAAACTCAAGCTGA
AGAGCGTCAAGTTGAAGAGCGGATCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail