Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g1456.t1
Gene name
Locationscaffold_01:3837259..3839881
Strand-
Gene length (bp)2622
Transcript length (bp)2622
Coding sequence length (bp)2622
Protein length (aa) 874

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12796 Ank_2 Ankyrin repeats (3 copies) 3.1E-14 619 709
PF12796 Ank_2 Ankyrin repeats (3 copies) 1.4E-12 651 742
PF12796 Ank_2 Ankyrin repeats (3 copies) 1.2E-14 716 808
PF12796 Ank_2 Ankyrin repeats (3 copies) 2.2E-11 797 867
PF13637 Ank_4 Ankyrin repeats (many copies) 8.0E-06 554 603
PF13637 Ank_4 Ankyrin repeats (many copies) 1.5E-06 648 698
PF13637 Ank_4 Ankyrin repeats (many copies) 1.2E-08 714 764
PF13637 Ank_4 Ankyrin repeats (many copies) 7.1E-05 755 797
PF13637 Ank_4 Ankyrin repeats (many copies) 5.5E-08 779 830
PF00023 Ank Ankyrin repeat 3.0E-03 744 776
PF13857 Ank_5 Ankyrin repeats (many copies) 5.2E-07 735 783

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g1456.t1
MSLSLADTEATLRAVDKATNELGFCRNRVWAIAKSLLGGPGEFPKLLPSLENSPHETKKEDHQLCTFDFCEQSRV
NFTLVTQRHEPPCDGSRCPLENFPSETLEAAVRKEQQITAWYLWETGTLQHNERYMAVSHVWSDGTGTGSQARGD
VNSCLLELFQEFALEFNCEGLWWDTICIPTKKELREKALKRMHLNYKAAAVTLVHDCFLREREWRDADLACFYIV
MSPWFSRGWTALELKMSQTVQIIFKGPEGPITKDLDRDILQAKSNDCPTTKHELAKDILKRFRREEVDGLDDLLA
ILSSRHTSWPRDMAIISGLIVGIELPENYPQQKIYQEILQKLGKISHAHLFHNSATMTNGYNWCPTNIYDLPVTL
SADVLQIEENGNLFGDWNIISLDFLKDESVVLGHAHPLIEGKVRLAQKEKDKHILLIEPDPTLSETRISRGLLVK
PSFRRDKIHFDCYCDYVGPVYFHPPLIRSNIPNFDPNDLFKIHVGKDETTHDGSHQSTERSQNAQSMIEDMKNGL
LNPQYRKRESDLKTLDLTAWDQLKLSEELIKAAGEGDYNNTKALLEKIRDPNQSDKSGWSALHHAVWYGQTKVAK
LLVKRLNPQQQTASGEEPLHLAADRGNEELMRILLARSTPNLNREDGLNALHLAAMNNVTGIVDELLQKWDINAT
GVKKQTALHMASFRGHEDVVHVLTKQNAKHDLKDCDQETALSLAVFNGHVNTVRLLKAAKADLDVRDNDGWTLLH
RAVNRGHIPAIETLAKLGANLEAQDNDGWTPLQWAAIKGYITAIETLAKLGANLEAQDNNGRTPLQCVASNGHIP
AIETLAKLGANLEAQDNSGRTPLQWAVSNGHVTAVKILCDLKARSQQV*
Coding >Pro_DTO377G3_2|g1456.t1
ATGTCCTTGTCATTAGCCGATACAGAGGCCACCTTACGAGCAGTCGACAAAGCCACGAACGAATTGGGCTTTTGT
CGCAACCGCGTCTGGGCGATAGCCAAGAGCCTACTGGGAGGTCCTGGAGAATTCCCGAAATTACTCCCTTCGCTG
GAAAATTCACCCCACGAGACAAAAAAGGAAGACCATCAGCTGTGTACTTTCGATTTTTGCGAGCAATCCCGAGTC
AATTTCACTCTGGTGACACAGCGCCACGAACCGCCTTGTGATGGAAGCCGCTGTCCTCTTGAAAATTTCCCTTCA
GAAACCCTGGAAGCAGCTGTCCGCAAGGAGCAACAAATCACAGCGTGGTATTTATGGGAAACGGGAACTCTTCAA
CACAACGAGCGGTATATGGCAGTATCCCATGTATGGTCGGACGGTACCGGCACCGGAAGCCAAGCCCGCGGCGAT
GTGAACAGCTGCTTGCTGGAGTTGTTTCAAGAATTTGCTCTCGAATTCAACTGTGAGGGTCTCTGGTGGGATACT
ATCTGCATTCCAACAAAGAAAGAGCTTCGCGAAAAAGCTTTAAAGCGCATGCACCTAAACTACAAGGCCGCGGCG
GTCACACTGGTCCACGATTGTTTCCTTAGAGAGCGCGAATGGCGTGATGCAGACTTAGCATGCTTTTATATCGTT
ATGTCTCCTTGGTTCAGCCGAGGCTGGACGGCATTGGAGTTGAAAATGTCCCAGACTGTTCAAATCATTTTCAAA
GGTCCCGAGGGCCCGATCACGAAGGACCTAGACAGAGACATATTACAAGCAAAGAGCAATGATTGCCCTACCACC
AAGCATGAACTTGCGAAAGACATACTCAAAAGATTTCGGAGGGAAGAAGTTGACGGATTGGATGATCTTCTAGCA
ATTCTCAGTTCACGCCACACATCTTGGCCAAGAGACATGGCGATCATTTCAGGACTCATTGTTGGAATCGAATTG
CCAGAAAACTACCCCCAACAGAAGATTTATCAAGAGATTCTGCAGAAGCTTGGCAAAATATCACATGCGCATCTG
TTCCACAATTCAGCAACTATGACGAATGGATACAACTGGTGCCCTACAAACATCTATGATCTACCTGTTACACTT
TCAGCCGATGTCCTCCAGATTGAAGAGAATGGGAATTTGTTCGGAGATTGGAATATCATTTCTCTTGATTTTCTC
AAAGACGAAAGCGTTGTCTTAGGTCATGCCCATCCACTCATAGAAGGAAAGGTTCGCCTCGCCCAAAAAGAGAAA
GACAAGCATATCCTACTCATTGAGCCTGATCCCACTCTTAGTGAGACTAGAATAAGCAGAGGCCTTCTGGTCAAG
CCTTCGTTTAGGCGCGATAAGATTCATTTCGATTGTTATTGTGATTATGTCGGCCCGGTTTATTTCCATCCGCCA
TTAATCAGGTCAAATATCCCAAATTTTGACCCGAATGATCTATTCAAGATTCACGTTGGAAAAGATGAGACGACG
CACGATGGCAGCCATCAAAGCACCGAAAGGAGCCAAAATGCTCAGAGCATGATCGAGGATATGAAAAATGGTTTA
CTCAATCCGCAATACAGGAAACGGGAAAGTGATTTGAAAACACTTGACCTTACCGCATGGGACCAATTGAAATTA
TCAGAAGAGTTGATAAAGGCCGCCGGTGAAGGTGATTACAACAACACAAAAGCTCTCCTGGAGAAGATACGGGAT
CCGAACCAAAGTGATAAATCAGGGTGGTCTGCATTACATCATGCCGTTTGGTATGGCCAAACAAAGGTAGCCAAG
CTGCTTGTCAAAAGGTTGAATCCTCAACAGCAGACTGCCAGTGGCGAAGAACCACTTCACCTCGCGGCAGACCGT
GGCAATGAAGAACTGATGAGGATACTGCTGGCACGCTCTACTCCTAACTTGAATCGAGAAGATGGATTGAATGCT
CTACATCTGGCAGCGATGAATAATGTGACTGGAATCGTGGATGAACTCTTACAAAAGTGGGATATCAACGCAACT
GGTGTTAAGAAGCAGACTGCATTACATATGGCATCGTTTCGGGGCCATGAAGATGTAGTACATGTCCTGACCAAG
CAAAATGCCAAACACGATCTCAAAGACTGCGACCAGGAAACCGCTTTGTCACTAGCAGTTTTCAACGGCCACGTA
AATACCGTGCGGTTACTCAAAGCGGCAAAAGCTGATCTTGATGTCCGAGATAATGATGGCTGGACTCTGCTTCAT
CGAGCAGTGAACAGAGGTCATATTCCCGCTATCGAGACACTCGCCAAACTAGGAGCGAATCTCGAAGCCCAAGAT
AATGATGGCTGGACTCCGCTTCAATGGGCGGCGATCAAAGGTTATATTACCGCTATCGAGACACTCGCCAAACTA
GGAGCGAATCTCGAAGCCCAAGATAATAATGGCCGGACTCCGCTTCAATGCGTAGCAAGCAACGGTCATATTCCC
GCTATCGAGACACTCGCCAAACTAGGAGCGAATCTCGAAGCCCAAGATAATAGTGGCCGGACTCCGCTTCAATGG
GCAGTGAGCAACGGTCATGTCACCGCTGTCAAGATACTCTGTGACCTCAAAGCTAGGTCTCAACAAGTATAG
Transcript >Pro_DTO377G3_2|g1456.t1
ATGTCCTTGTCATTAGCCGATACAGAGGCCACCTTACGAGCAGTCGACAAAGCCACGAACGAATTGGGCTTTTGT
CGCAACCGCGTCTGGGCGATAGCCAAGAGCCTACTGGGAGGTCCTGGAGAATTCCCGAAATTACTCCCTTCGCTG
GAAAATTCACCCCACGAGACAAAAAAGGAAGACCATCAGCTGTGTACTTTCGATTTTTGCGAGCAATCCCGAGTC
AATTTCACTCTGGTGACACAGCGCCACGAACCGCCTTGTGATGGAAGCCGCTGTCCTCTTGAAAATTTCCCTTCA
GAAACCCTGGAAGCAGCTGTCCGCAAGGAGCAACAAATCACAGCGTGGTATTTATGGGAAACGGGAACTCTTCAA
CACAACGAGCGGTATATGGCAGTATCCCATGTATGGTCGGACGGTACCGGCACCGGAAGCCAAGCCCGCGGCGAT
GTGAACAGCTGCTTGCTGGAGTTGTTTCAAGAATTTGCTCTCGAATTCAACTGTGAGGGTCTCTGGTGGGATACT
ATCTGCATTCCAACAAAGAAAGAGCTTCGCGAAAAAGCTTTAAAGCGCATGCACCTAAACTACAAGGCCGCGGCG
GTCACACTGGTCCACGATTGTTTCCTTAGAGAGCGCGAATGGCGTGATGCAGACTTAGCATGCTTTTATATCGTT
ATGTCTCCTTGGTTCAGCCGAGGCTGGACGGCATTGGAGTTGAAAATGTCCCAGACTGTTCAAATCATTTTCAAA
GGTCCCGAGGGCCCGATCACGAAGGACCTAGACAGAGACATATTACAAGCAAAGAGCAATGATTGCCCTACCACC
AAGCATGAACTTGCGAAAGACATACTCAAAAGATTTCGGAGGGAAGAAGTTGACGGATTGGATGATCTTCTAGCA
ATTCTCAGTTCACGCCACACATCTTGGCCAAGAGACATGGCGATCATTTCAGGACTCATTGTTGGAATCGAATTG
CCAGAAAACTACCCCCAACAGAAGATTTATCAAGAGATTCTGCAGAAGCTTGGCAAAATATCACATGCGCATCTG
TTCCACAATTCAGCAACTATGACGAATGGATACAACTGGTGCCCTACAAACATCTATGATCTACCTGTTACACTT
TCAGCCGATGTCCTCCAGATTGAAGAGAATGGGAATTTGTTCGGAGATTGGAATATCATTTCTCTTGATTTTCTC
AAAGACGAAAGCGTTGTCTTAGGTCATGCCCATCCACTCATAGAAGGAAAGGTTCGCCTCGCCCAAAAAGAGAAA
GACAAGCATATCCTACTCATTGAGCCTGATCCCACTCTTAGTGAGACTAGAATAAGCAGAGGCCTTCTGGTCAAG
CCTTCGTTTAGGCGCGATAAGATTCATTTCGATTGTTATTGTGATTATGTCGGCCCGGTTTATTTCCATCCGCCA
TTAATCAGGTCAAATATCCCAAATTTTGACCCGAATGATCTATTCAAGATTCACGTTGGAAAAGATGAGACGACG
CACGATGGCAGCCATCAAAGCACCGAAAGGAGCCAAAATGCTCAGAGCATGATCGAGGATATGAAAAATGGTTTA
CTCAATCCGCAATACAGGAAACGGGAAAGTGATTTGAAAACACTTGACCTTACCGCATGGGACCAATTGAAATTA
TCAGAAGAGTTGATAAAGGCCGCCGGTGAAGGTGATTACAACAACACAAAAGCTCTCCTGGAGAAGATACGGGAT
CCGAACCAAAGTGATAAATCAGGGTGGTCTGCATTACATCATGCCGTTTGGTATGGCCAAACAAAGGTAGCCAAG
CTGCTTGTCAAAAGGTTGAATCCTCAACAGCAGACTGCCAGTGGCGAAGAACCACTTCACCTCGCGGCAGACCGT
GGCAATGAAGAACTGATGAGGATACTGCTGGCACGCTCTACTCCTAACTTGAATCGAGAAGATGGATTGAATGCT
CTACATCTGGCAGCGATGAATAATGTGACTGGAATCGTGGATGAACTCTTACAAAAGTGGGATATCAACGCAACT
GGTGTTAAGAAGCAGACTGCATTACATATGGCATCGTTTCGGGGCCATGAAGATGTAGTACATGTCCTGACCAAG
CAAAATGCCAAACACGATCTCAAAGACTGCGACCAGGAAACCGCTTTGTCACTAGCAGTTTTCAACGGCCACGTA
AATACCGTGCGGTTACTCAAAGCGGCAAAAGCTGATCTTGATGTCCGAGATAATGATGGCTGGACTCTGCTTCAT
CGAGCAGTGAACAGAGGTCATATTCCCGCTATCGAGACACTCGCCAAACTAGGAGCGAATCTCGAAGCCCAAGAT
AATGATGGCTGGACTCCGCTTCAATGGGCGGCGATCAAAGGTTATATTACCGCTATCGAGACACTCGCCAAACTA
GGAGCGAATCTCGAAGCCCAAGATAATAATGGCCGGACTCCGCTTCAATGCGTAGCAAGCAACGGTCATATTCCC
GCTATCGAGACACTCGCCAAACTAGGAGCGAATCTCGAAGCCCAAGATAATAGTGGCCGGACTCCGCTTCAATGG
GCAGTGAGCAACGGTCATGTCACCGCTGTCAAGATACTCTGTGACCTCAAAGCTAGGTCTCAACAAGTATAG
Gene >Pro_DTO377G3_2|g1456.t1
ATGTCCTTGTCATTAGCCGATACAGAGGCCACCTTACGAGCAGTCGACAAAGCCACGAACGAATTGGGCTTTTGT
CGCAACCGCGTCTGGGCGATAGCCAAGAGCCTACTGGGAGGTCCTGGAGAATTCCCGAAATTACTCCCTTCGCTG
GAAAATTCACCCCACGAGACAAAAAAGGAAGACCATCAGCTGTGTACTTTCGATTTTTGCGAGCAATCCCGAGTC
AATTTCACTCTGGTGACACAGCGCCACGAACCGCCTTGTGATGGAAGCCGCTGTCCTCTTGAAAATTTCCCTTCA
GAAACCCTGGAAGCAGCTGTCCGCAAGGAGCAACAAATCACAGCGTGGTATTTATGGGAAACGGGAACTCTTCAA
CACAACGAGCGGTATATGGCAGTATCCCATGTATGGTCGGACGGTACCGGCACCGGAAGCCAAGCCCGCGGCGAT
GTGAACAGCTGCTTGCTGGAGTTGTTTCAAGAATTTGCTCTCGAATTCAACTGTGAGGGTCTCTGGTGGGATACT
ATCTGCATTCCAACAAAGAAAGAGCTTCGCGAAAAAGCTTTAAAGCGCATGCACCTAAACTACAAGGCCGCGGCG
GTCACACTGGTCCACGATTGTTTCCTTAGAGAGCGCGAATGGCGTGATGCAGACTTAGCATGCTTTTATATCGTT
ATGTCTCCTTGGTTCAGCCGAGGCTGGACGGCATTGGAGTTGAAAATGTCCCAGACTGTTCAAATCATTTTCAAA
GGTCCCGAGGGCCCGATCACGAAGGACCTAGACAGAGACATATTACAAGCAAAGAGCAATGATTGCCCTACCACC
AAGCATGAACTTGCGAAAGACATACTCAAAAGATTTCGGAGGGAAGAAGTTGACGGATTGGATGATCTTCTAGCA
ATTCTCAGTTCACGCCACACATCTTGGCCAAGAGACATGGCGATCATTTCAGGACTCATTGTTGGAATCGAATTG
CCAGAAAACTACCCCCAACAGAAGATTTATCAAGAGATTCTGCAGAAGCTTGGCAAAATATCACATGCGCATCTG
TTCCACAATTCAGCAACTATGACGAATGGATACAACTGGTGCCCTACAAACATCTATGATCTACCTGTTACACTT
TCAGCCGATGTCCTCCAGATTGAAGAGAATGGGAATTTGTTCGGAGATTGGAATATCATTTCTCTTGATTTTCTC
AAAGACGAAAGCGTTGTCTTAGGTCATGCCCATCCACTCATAGAAGGAAAGGTTCGCCTCGCCCAAAAAGAGAAA
GACAAGCATATCCTACTCATTGAGCCTGATCCCACTCTTAGTGAGACTAGAATAAGCAGAGGCCTTCTGGTCAAG
CCTTCGTTTAGGCGCGATAAGATTCATTTCGATTGTTATTGTGATTATGTCGGCCCGGTTTATTTCCATCCGCCA
TTAATCAGGTCAAATATCCCAAATTTTGACCCGAATGATCTATTCAAGATTCACGTTGGAAAAGATGAGACGACG
CACGATGGCAGCCATCAAAGCACCGAAAGGAGCCAAAATGCTCAGAGCATGATCGAGGATATGAAAAATGGTTTA
CTCAATCCGCAATACAGGAAACGGGAAAGTGATTTGAAAACACTTGACCTTACCGCATGGGACCAATTGAAATTA
TCAGAAGAGTTGATAAAGGCCGCCGGTGAAGGTGATTACAACAACACAAAAGCTCTCCTGGAGAAGATACGGGAT
CCGAACCAAAGTGATAAATCAGGGTGGTCTGCATTACATCATGCCGTTTGGTATGGCCAAACAAAGGTAGCCAAG
CTGCTTGTCAAAAGGTTGAATCCTCAACAGCAGACTGCCAGTGGCGAAGAACCACTTCACCTCGCGGCAGACCGT
GGCAATGAAGAACTGATGAGGATACTGCTGGCACGCTCTACTCCTAACTTGAATCGAGAAGATGGATTGAATGCT
CTACATCTGGCAGCGATGAATAATGTGACTGGAATCGTGGATGAACTCTTACAAAAGTGGGATATCAACGCAACT
GGTGTTAAGAAGCAGACTGCATTACATATGGCATCGTTTCGGGGCCATGAAGATGTAGTACATGTCCTGACCAAG
CAAAATGCCAAACACGATCTCAAAGACTGCGACCAGGAAACCGCTTTGTCACTAGCAGTTTTCAACGGCCACGTA
AATACCGTGCGGTTACTCAAAGCGGCAAAAGCTGATCTTGATGTCCGAGATAATGATGGCTGGACTCTGCTTCAT
CGAGCAGTGAACAGAGGTCATATTCCCGCTATCGAGACACTCGCCAAACTAGGAGCGAATCTCGAAGCCCAAGAT
AATGATGGCTGGACTCCGCTTCAATGGGCGGCGATCAAAGGTTATATTACCGCTATCGAGACACTCGCCAAACTA
GGAGCGAATCTCGAAGCCCAAGATAATAATGGCCGGACTCCGCTTCAATGCGTAGCAAGCAACGGTCATATTCCC
GCTATCGAGACACTCGCCAAACTAGGAGCGAATCTCGAAGCCCAAGATAATAGTGGCCGGACTCCGCTTCAATGG
GCAGTGAGCAACGGTCATGTCACCGCTGTCAAGATACTCTGTGACCTCAAAGCTAGGTCTCAACAAGTATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail