Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g1446.t1
Gene name
Locationscaffold_01:3807938..3811267
Strand-
Gene length (bp)3329
Transcript length (bp)3279
Coding sequence length (bp)3279
Protein length (aa) 1093

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01074 Glyco_hydro_38N Glycosyl hydrolases family 38 N-terminal domain 5.6E-88 285 550
PF07748 Glyco_hydro_38C Glycosyl hydrolases family 38 C-terminal domain 7.8E-58 730 938
PF09261 Alpha-mann_mid Alpha mannosidase middle domain 4.7E-27 557 656
PF17677 Glyco_hydro38C2 Glycosyl hydrolases family 38 C-terminal beta sandwich domain 3.0E-10 1022 1089

GO

GO Term Description Terminal node
GO:0004559 alpha-mannosidase activity Yes
GO:0006013 mannose metabolic process Yes
GO:0005996 monosaccharide metabolic process No
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0008150 biological_process No
GO:0044238 primary metabolic process No
GO:0008152 metabolic process No
GO:0044281 small molecule metabolic process No
GO:0015923 mannosidase activity No
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds No
GO:0005975 carbohydrate metabolic process No
GO:0019318 hexose metabolic process No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No
GO:0016787 hydrolase activity No
GO:0071704 organic substance metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g1446.t1
MGGEVPSRPAPPALPQLAERPVGQRIKKIYTDRLNQFTSNGQYEGQNLVSKYHEATNSDEDHVKLSVYSVPDLQR
PTFKEATSQEFKPTRIGASFGPSWSTHWFRIHLTVPEDMLQREHLEFHWDANNEGLIWTEDGHPLQGLTGGGERT
EFVLPKQWCDGKEHTFYIEMACNGMFGNAPGGDSIQPPNPDKQFTLSTARITAVNLAARALFYDFWIIGDAAREF
PGDSWESHEANVVANSIIDTFIAGNGSNDSINEGRKVARKYLGDKVDSSDVYDTDTQPIVYAIGHCHIDTCWLWP
WAETKRKVARSWSNQCDLMERYPEHRFACSQAQQFKWLKQYYPSVFDRVKRWVRKGNFQPIGGSWVEHDTNMPSG
ESLVRQFLYGQRFFEANFGKRCTTFWLPDTFGYSTQIPQICRLAGMSRFFTQKLSWNNINNFPHTTFQWVALDGS
QVLCHMAPAETYTAEAHFGDVKRSVTQHKSLDTDKSSLLVFGKGDGGGGPTFGHLEKLRRCRGLSDQVGSLPRVK
MGESVDDFFAKLETKAASGTDFATWYGELYFELHRGTYTTQANNKRNNRKAEFLLREIELLATFATIKASNDGYR
YPKKEIDEMWEGTLLCQFHDCLPGSSIEMCYDDSDKLYAEIFEIGAKLRKNALKALGLTSDVTGGNFMALNTLPW
ARSEVVAIPPAVSAYNGSRYAVAAGTTGVMQVQRADFKTTTSVTVTEIKSGVFRLENGKLRVDVHDGVITSLYDV
QADREIVAKDRKAGQLVIFDDKPLYWQAWDVEVFHIESRKELPGGKTTIVENDPHRVSVMTETQISEKSWIKTTI
SLSASTSDEPSYVEMESEVEWQETMKFLKVEFPVDIVNTEASYETQYGIVRRPTHYNTSWDMAKFEVCCHKWADL
SENGYGVSILNDSKYGFATCGNLMRLSLLRAPKAPDAHADMGRHHIRYAILPHAGALDARTIRAGFNFNNPLIVE
KAGPKASASNALFKSLSIKGAPSLILDVVKRGEDDVDVSWDGVPTRPGKSVILRVYESLGGKARGTIETSLPVKN
VFKCNILEDDENHGLDIESAGGLSAIKIELRAFEVATYRLQL*
Coding >Pro_DTO377G3_2|g1446.t1
ATGGGTGGGGAAGTTCCCTCTCGCCCCGCTCCTCCAGCTTTACCCCAGTTAGCTGAACGTCCGGTCGGCCAACGT
ATCAAGAAGATCTATACCGATAGATTGAATCAGTTCACGTCGAACGGCCAGTACGAAGGCCAAAACCTTGTCTCA
AAGTACCACGAAGCCACAAACTCGGACGAAGATCATGTCAAGCTCTCTGTTTACTCGGTTCCGGACCTGCAGCGA
CCGACCTTCAAAGAGGCGACCTCTCAGGAATTCAAGCCCACTCGCATAGGCGCCTCCTTTGGCCCCAGTTGGTCC
ACACATTGGTTCCGGATTCACCTCACAGTGCCCGAGGACATGCTCCAACGGGAGCATCTAGAGTTCCACTGGGAT
GCCAACAACGAAGGCCTGATCTGGACAGAGGACGGACACCCGCTGCAGGGCTTGACTGGAGGCGGAGAACGGACC
GAGTTTGTTCTCCCAAAACAATGGTGCGATGGGAAAGAGCATACCTTCTACATTGAAATGGCTTGCAATGGCATG
TTCGGCAATGCTCCTGGTGGCGATTCGATCCAGCCACCAAATCCCGATAAACAGTTCACGCTCAGCACTGCGCGA
ATCACCGCGGTAAACCTGGCTGCCCGGGCGCTTTTCTATGATTTCTGGATTATTGGTGACGCCGCCCGGGAATTC
CCAGGGGATTCATGGGAGTCGCATGAAGCCAATGTTGTGGCCAATTCTATCATCGATACTTTCATTGCGGGCAAC
GGAAGCAATGATTCTATCAACGAGGGGCGGAAGGTTGCTAGAAAGTACCTTGGCGACAAAGTAGACTCATCCGAT
GTTTACGACACAGACACGCAGCCGATAGTTTATGCCATTGGCCATTGTCATATTGATACTTGCTGGCTGTGGCCT
TGGGCTGAGACCAAGCGAAAGGTAGCACGGTCATGGTCTAACCAATGTGATCTGATGGAACGATATCCTGAGCAC
CGTTTTGCTTGTTCTCAGGCTCAACAATTCAAATGGCTCAAGCAGTACTACCCATCCGTTTTTGATCGTGTGAAG
CGCTGGGTAAGGAAGGGCAACTTCCAGCCCATCGGTGGGAGCTGGGTCGAGCACGATACAAATATGCCAAGTGGA
GAGTCGCTGGTCAGACAGTTCTTGTATGGACAGCGATTCTTCGAGGCAAACTTCGGTAAGCGATGCACAACTTTC
TGGTTGCCAGATACGTTCGGGTACTCTACACAGATCCCTCAGATATGCCGCCTGGCTGGGATGAGCCGTTTCTTC
ACCCAGAAGCTCAGCTGGAACAACATCAATAACTTCCCTCACACTACATTCCAGTGGGTTGCGCTTGATGGTAGT
CAAGTCTTGTGCCACATGGCTCCTGCTGAGACCTACACAGCTGAAGCGCATTTCGGTGATGTCAAACGCAGTGTC
ACTCAGCATAAGTCTCTAGACACGGACAAGTCATCGCTGCTTGTATTCGGAAAAGGCGACGGAGGTGGTGGTCCG
ACTTTTGGGCACCTCGAAAAGCTGCGTCGATGCCGCGGTCTCAGTGATCAGGTCGGCTCATTGCCCCGAGTGAAA
ATGGGCGAGTCGGTAGATGATTTCTTTGCAAAGTTGGAGACAAAGGCTGCCTCTGGCACTGATTTTGCTACCTGG
TACGGCGAGCTTTACTTTGAGTTGCACCGTGGAACATACACCACTCAAGCGAACAATAAGCGCAATAACCGCAAG
GCCGAGTTTTTGCTGCGTGAGATTGAGCTTCTCGCGACATTCGCTACCATCAAGGCTTCTAATGATGGATATCGG
TATCCCAAAAAGGAGATTGATGAGATGTGGGAAGGAACCCTCCTTTGCCAATTCCATGATTGCTTGCCGGGTAGC
TCCATCGAAATGTGCTATGATGACTCAGACAAGTTGTATGCCGAAATCTTTGAGATTGGAGCTAAGCTGCGAAAG
AATGCCCTCAAGGCTTTGGGACTCACTAGCGATGTCACGGGTGGAAATTTCATGGCCCTCAATACCTTGCCATGG
GCCCGATCAGAAGTGGTCGCAATTCCTCCAGCAGTGTCCGCATACAATGGATCCAGATATGCTGTGGCTGCTGGT
ACAACTGGAGTGATGCAAGTTCAGCGGGCTGACTTCAAAACAACCACTTCGGTGACCGTTACTGAGATCAAATCT
GGTGTCTTCCGCCTGGAGAACGGTAAACTTAGGGTTGATGTCCATGACGGGGTTATCACATCCTTGTACGATGTG
CAAGCCGATAGAGAAATCGTCGCAAAGGACCGCAAGGCTGGCCAACTTGTTATCTTCGACGACAAGCCTCTTTAC
TGGCAAGCATGGGATGTCGAGGTGTTCCATATTGAGTCACGAAAGGAGTTGCCCGGGGGTAAGACGACCATTGTA
GAAAATGACCCACACCGAGTGAGTGTCATGACTGAGACACAGATCAGCGAGAAGAGCTGGATCAAGACCACGATC
AGCCTGTCGGCATCCACATCCGATGAGCCCTCATACGTGGAAATGGAGAGCGAGGTGGAATGGCAAGAGACGATG
AAGTTCCTGAAGGTTGAGTTCCCAGTTGATATCGTCAACACCGAAGCATCCTACGAGACCCAGTATGGCATCGTT
AGGCGCCCGACGCATTATAACACAAGTTGGGATATGGCCAAATTCGAAGTCTGCTGTCACAAATGGGCCGACCTC
TCCGAAAACGGCTACGGAGTCTCCATCCTAAACGACTCTAAATACGGCTTCGCAACATGCGGTAACCTGATGCGC
TTATCGCTTCTCCGTGCCCCCAAGGCGCCAGATGCCCACGCCGACATGGGTCGCCACCACATTCGCTACGCAATT
CTTCCCCACGCCGGTGCCCTTGATGCCCGAACAATCCGCGCAGGCTTCAATTTCAATAACCCACTCATTGTTGAG
AAAGCCGGCCCTAAAGCATCTGCTTCCAATGCTTTGTTTAAATCTCTATCTATCAAGGGCGCGCCATCCTTGATT
CTAGATGTTGTCAAGCGCGGCGAGGATGATGTTGACGTTTCCTGGGATGGTGTTCCTACCCGTCCTGGAAAGAGT
GTTATTCTGCGTGTCTATGAATCGCTTGGTGGTAAGGCTCGCGGTACCATTGAGACCTCACTGCCCGTGAAGAAT
GTTTTCAAGTGCAATATTCTCGAGGATGATGAGAACCACGGGCTTGATATTGAATCTGCAGGCGGTCTTTCCGCG
ATCAAGATTGAGTTGAGGGCGTTTGAGGTCGCTACATACCGACTGCAGCTGTGA
Transcript >Pro_DTO377G3_2|g1446.t1
ATGGGTGGGGAAGTTCCCTCTCGCCCCGCTCCTCCAGCTTTACCCCAGTTAGCTGAACGTCCGGTCGGCCAACGT
ATCAAGAAGATCTATACCGATAGATTGAATCAGTTCACGTCGAACGGCCAGTACGAAGGCCAAAACCTTGTCTCA
AAGTACCACGAAGCCACAAACTCGGACGAAGATCATGTCAAGCTCTCTGTTTACTCGGTTCCGGACCTGCAGCGA
CCGACCTTCAAAGAGGCGACCTCTCAGGAATTCAAGCCCACTCGCATAGGCGCCTCCTTTGGCCCCAGTTGGTCC
ACACATTGGTTCCGGATTCACCTCACAGTGCCCGAGGACATGCTCCAACGGGAGCATCTAGAGTTCCACTGGGAT
GCCAACAACGAAGGCCTGATCTGGACAGAGGACGGACACCCGCTGCAGGGCTTGACTGGAGGCGGAGAACGGACC
GAGTTTGTTCTCCCAAAACAATGGTGCGATGGGAAAGAGCATACCTTCTACATTGAAATGGCTTGCAATGGCATG
TTCGGCAATGCTCCTGGTGGCGATTCGATCCAGCCACCAAATCCCGATAAACAGTTCACGCTCAGCACTGCGCGA
ATCACCGCGGTAAACCTGGCTGCCCGGGCGCTTTTCTATGATTTCTGGATTATTGGTGACGCCGCCCGGGAATTC
CCAGGGGATTCATGGGAGTCGCATGAAGCCAATGTTGTGGCCAATTCTATCATCGATACTTTCATTGCGGGCAAC
GGAAGCAATGATTCTATCAACGAGGGGCGGAAGGTTGCTAGAAAGTACCTTGGCGACAAAGTAGACTCATCCGAT
GTTTACGACACAGACACGCAGCCGATAGTTTATGCCATTGGCCATTGTCATATTGATACTTGCTGGCTGTGGCCT
TGGGCTGAGACCAAGCGAAAGGTAGCACGGTCATGGTCTAACCAATGTGATCTGATGGAACGATATCCTGAGCAC
CGTTTTGCTTGTTCTCAGGCTCAACAATTCAAATGGCTCAAGCAGTACTACCCATCCGTTTTTGATCGTGTGAAG
CGCTGGGTAAGGAAGGGCAACTTCCAGCCCATCGGTGGGAGCTGGGTCGAGCACGATACAAATATGCCAAGTGGA
GAGTCGCTGGTCAGACAGTTCTTGTATGGACAGCGATTCTTCGAGGCAAACTTCGGTAAGCGATGCACAACTTTC
TGGTTGCCAGATACGTTCGGGTACTCTACACAGATCCCTCAGATATGCCGCCTGGCTGGGATGAGCCGTTTCTTC
ACCCAGAAGCTCAGCTGGAACAACATCAATAACTTCCCTCACACTACATTCCAGTGGGTTGCGCTTGATGGTAGT
CAAGTCTTGTGCCACATGGCTCCTGCTGAGACCTACACAGCTGAAGCGCATTTCGGTGATGTCAAACGCAGTGTC
ACTCAGCATAAGTCTCTAGACACGGACAAGTCATCGCTGCTTGTATTCGGAAAAGGCGACGGAGGTGGTGGTCCG
ACTTTTGGGCACCTCGAAAAGCTGCGTCGATGCCGCGGTCTCAGTGATCAGGTCGGCTCATTGCCCCGAGTGAAA
ATGGGCGAGTCGGTAGATGATTTCTTTGCAAAGTTGGAGACAAAGGCTGCCTCTGGCACTGATTTTGCTACCTGG
TACGGCGAGCTTTACTTTGAGTTGCACCGTGGAACATACACCACTCAAGCGAACAATAAGCGCAATAACCGCAAG
GCCGAGTTTTTGCTGCGTGAGATTGAGCTTCTCGCGACATTCGCTACCATCAAGGCTTCTAATGATGGATATCGG
TATCCCAAAAAGGAGATTGATGAGATGTGGGAAGGAACCCTCCTTTGCCAATTCCATGATTGCTTGCCGGGTAGC
TCCATCGAAATGTGCTATGATGACTCAGACAAGTTGTATGCCGAAATCTTTGAGATTGGAGCTAAGCTGCGAAAG
AATGCCCTCAAGGCTTTGGGACTCACTAGCGATGTCACGGGTGGAAATTTCATGGCCCTCAATACCTTGCCATGG
GCCCGATCAGAAGTGGTCGCAATTCCTCCAGCAGTGTCCGCATACAATGGATCCAGATATGCTGTGGCTGCTGGT
ACAACTGGAGTGATGCAAGTTCAGCGGGCTGACTTCAAAACAACCACTTCGGTGACCGTTACTGAGATCAAATCT
GGTGTCTTCCGCCTGGAGAACGGTAAACTTAGGGTTGATGTCCATGACGGGGTTATCACATCCTTGTACGATGTG
CAAGCCGATAGAGAAATCGTCGCAAAGGACCGCAAGGCTGGCCAACTTGTTATCTTCGACGACAAGCCTCTTTAC
TGGCAAGCATGGGATGTCGAGGTGTTCCATATTGAGTCACGAAAGGAGTTGCCCGGGGGTAAGACGACCATTGTA
GAAAATGACCCACACCGAGTGAGTGTCATGACTGAGACACAGATCAGCGAGAAGAGCTGGATCAAGACCACGATC
AGCCTGTCGGCATCCACATCCGATGAGCCCTCATACGTGGAAATGGAGAGCGAGGTGGAATGGCAAGAGACGATG
AAGTTCCTGAAGGTTGAGTTCCCAGTTGATATCGTCAACACCGAAGCATCCTACGAGACCCAGTATGGCATCGTT
AGGCGCCCGACGCATTATAACACAAGTTGGGATATGGCCAAATTCGAAGTCTGCTGTCACAAATGGGCCGACCTC
TCCGAAAACGGCTACGGAGTCTCCATCCTAAACGACTCTAAATACGGCTTCGCAACATGCGGTAACCTGATGCGC
TTATCGCTTCTCCGTGCCCCCAAGGCGCCAGATGCCCACGCCGACATGGGTCGCCACCACATTCGCTACGCAATT
CTTCCCCACGCCGGTGCCCTTGATGCCCGAACAATCCGCGCAGGCTTCAATTTCAATAACCCACTCATTGTTGAG
AAAGCCGGCCCTAAAGCATCTGCTTCCAATGCTTTGTTTAAATCTCTATCTATCAAGGGCGCGCCATCCTTGATT
CTAGATGTTGTCAAGCGCGGCGAGGATGATGTTGACGTTTCCTGGGATGGTGTTCCTACCCGTCCTGGAAAGAGT
GTTATTCTGCGTGTCTATGAATCGCTTGGTGGTAAGGCTCGCGGTACCATTGAGACCTCACTGCCCGTGAAGAAT
GTTTTCAAGTGCAATATTCTCGAGGATGATGAGAACCACGGGCTTGATATTGAATCTGCAGGCGGTCTTTCCGCG
ATCAAGATTGAGTTGAGGGCGTTTGAGGTCGCTACATACCGACTGCAGCTGTGA
Gene >Pro_DTO377G3_2|g1446.t1
ATGGGTGGGGAAGTTCCCTCTCGCCCCGCTCCTCCAGCTTTACCCCAGTTAGCTGAACGTCCGGTCGGCCAACGT
ATCAAGAAGATCTATACCGATAGATTGAATCAGTTCACGTCGAACGGCCAGTACGAAGGCCAAAACCTTGTCTCA
AAGTACCACGAAGCCACAAACTCGGACGAAGATCATGTCAAGCTCTCTGTTTACTCGGTTCCGGACCTGCAGCGA
CCGACCTTCAAAGAGGCGACCTCTCAGGAATTCAAGCCCACTCGCATAGGCGCCTCCTTTGGCCCCAGTTGGTCC
ACACATTGGTTCCGGATTCACCTCACAGTGCCCGAGGACATGCTCCAACGGGAGCATCTAGAGTTCCACTGGGAT
GCCAACAACGAAGGCCTGATCTGGACAGAGGACGGACACCCGCTGCAGGGCTTGACTGGAGGCGGAGAACGGACC
GAGTTTGTTCTCCCAAAACAATGGTGCGATGGGAAAGAGCATACCTTCTACATTGAAATGGCTTGCAATGGCATG
TTCGGCAATGCTCCTGGTGGCGATTCGATCCAGCCACCAAATCCCGATAAACAGTTCACGCTCAGCACTGCGCGA
ATCACCGCGGTAAACCTGGCTGCCCGGGCGCTTTTCTATGATTTCTGGATTATTGGTGACGCCGCCCGGGAATTC
CCAGGGGATTCATGGGAGTCGCATGAAGCCAATGTTGTGGCCAATTCTATCATCGATACTTTCATTGCGGGCAAC
GGAAGCAATGATTCTATCAACGAGGGGCGGAAGGTTGCTAGAAAGTACCTTGGCGACAAAGTAGACTCATCCGAT
GTTTACGACACAGACACGCAGCCGATAGTTTATGCCATTGGCCATTGTCATATTGATACTTGCTGGCTGTGGCCT
TGGGCTGAGACCAAGCGAAAGGTAGCACGGTCATGGTCTAACCAATGTGATCTGATGGAACGATATCCTGAGCAC
CGTTTTGCTTGTTCTCAGGCTCAACAATTCAAATGGCTCAAGCAGTACTACCCATCCGTTTTTGATCGTGTGAAG
CGCTGGGTAAGGAAGGGCAACTTCCAGCCCATCGGTGGGAGCTGGGTCGAGCACGATACAAATATGCCAAGTGGA
GAGTCGCTGGTCAGACAGTTCTTGTATGGACAGCGATTCTTCGAGGCAAACTTCGGTAAGCGATGCACAACTTTC
TGGTTGCCAGATACGTTCGGGTACTCTACACAGATCCCTCAGATATGCCGCCTGGCTGGGATGAGCCGTTTCTTC
ACCCAGAAGCTCAGCTGGAACAACATCAATAACTTCCCTCACACTACATTCCAGTGGGTTGCGCTTGATGGTAGT
CAAGTCTTGTGCCACATGGCTCCTGCTGAGACCTACACAGCTGAAGCGCATTTCGGTGATGTCAAACGCAGTGTC
ACTCAGCATAAGTCTCTAGACACGGACAAGTCATCGCTGCTTGTATTCGGAAAAGGCGACGGAGGTGGTGGTCCG
ACTTTTGGGCACCTCGAAAAGCTGCGTCGATGCCGCGGTCTCAGTGATCAGGTCGGCTCATTGCCCCGAGTGAAA
ATGGGCGAGTCGGTAGATGATTTCTTTGCAAAGTTGGAGACAAAGGCTGCCTCTGGCACTGATTTTGCTACCTGG
TACGGCGAGCTTTACTTTGAGTTGCACCGTGGAACATACACCACTCAAGCGAACAATAAGCGCAATAACCGCAAG
GCCGAGTTTTTGCTGCGTGAGATTGAGCTTCTCGCGACATTCGCTACCATCAAGGCTTCTAATGATGGATATCGG
TATCCCAAAAAGGAGATTGATGAGATGTGGGAAGGAACCCTCCTTTGCCAATTCCATGATTGCTTGCCGGGTAGC
TCCATCGAAATGTGCTATGATGACTCAGACAAGTTGTATGCCGAAATCTTTGAGATTGGAGCTAAGCTGCGAAAG
AATGCCCTCAAGGCTTTGGGACTCACTAGCGATGTCACGGGTGGAAATTTCATGGCCCTCAATACCTTGCCATGG
GCCCGATCAGAAGTGGTCGCAATTCCTCCAGCAGTGTCCGCATACAATGGATCCAGATATGCTGTGGCTGCTGGT
ACAACTGGAGTGATGCAAGTTCAGCGGGCTGACTTCAAAACAACCACTTCGGTGACCGTTACTGAGATCAAATCT
GGTGTCTTCCGCCTGGAGAACGGTAAACTTAGGGTTGATGTCCATGACGGGGTTATCACATCCTTGTACGATGTG
CAAGCCGATAGAGAAATCGTCGCAAAGGACCGCAAGGCTGGCCAACTTGTTATCTTCGACGACAAGCCTCTTTAC
TGGCAAGCATGGGATGTCGAGGTGTTCCATATTGAGTCACGAAAGGAGTTGCCCGGGGGTAAGACGACCATTGTA
GAAAATGACCCACACCGAGTGAGTGTCATGACTGAGACACAGATCAGCGAGAAGAGCTGGATCAAGACCACGATC
AGCCTGTCGGCATCCACATCCGATGAGCCCTCATACGTGGAAATGGAGAGCGAGGTGGAATGGCAAGAGACGATG
AAGTTCCTGAAGGTTGAGTTCCCAGTTGATATCGTCAACACCGAAGCATCCTACGAGACCCAGTATGGCATCGTT
AGGCGCCCGACGCATTATAACACAAGGTATGCACCGACTTCCCATCTCCTTCACAACGATACTAAGTAATATGCA
GTTGGGATATGGCCAAATTCGAAGTCTGCTGTCACAAATGGGCCGACCTCTCCGAAAACGGCTACGGAGTCTCCA
TCCTAAACGACTCTAAATACGGCTTCGCAACATGCGGTAACCTGATGCGCTTATCGCTTCTCCGTGCCCCCAAGG
CGCCAGATGCCCACGCCGACATGGGTCGCCACCACATTCGCTACGCAATTCTTCCCCACGCCGGTGCCCTTGATG
CCCGAACAATCCGCGCAGGCTTCAATTTCAATAACCCACTCATTGTTGAGAAAGCCGGCCCTAAAGCATCTGCTT
CCAATGCTTTGTTTAAATCTCTATCTATCAAGGGCGCGCCATCCTTGATTCTAGATGTTGTCAAGCGCGGCGAGG
ATGATGTTGACGTTTCCTGGGATGGTGTTCCTACCCGTCCTGGAAAGAGTGTTATTCTGCGTGTCTATGAATCGC
TTGGTGGTAAGGCTCGCGGTACCATTGAGACCTCACTGCCCGTGAAGAATGTTTTCAAGTGCAATATTCTCGAGG
ATGATGAGAACCACGGGCTTGATATTGAATCTGCAGGCGGTCTTTCCGCGATCAAGATTGAGTTGAGGGCGTTTG
AGGTCGCTACATACCGACTGCAGCTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail