Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g1445.t1
Gene name
Locationscaffold_01:3806647..3807591
Strand+
Gene length (bp)944
Transcript length (bp)687
Coding sequence length (bp)687
Protein length (aa) 229

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09340 NuA4 Histone acetyltransferase subunit NuA4 1.1E-27 51 141

GO

GO Term Description Terminal node
GO:0000123 histone acetyltransferase complex Yes
GO:0016573 histone acetylation Yes
GO:0016569 covalent chromatin modification No
GO:0044238 primary metabolic process No
GO:1990234 transferase complex No
GO:0036211 protein modification process No
GO:0044260 cellular macromolecule metabolic process No
GO:0016570 histone modification No
GO:0044446 intracellular organelle part No
GO:0071704 organic substance metabolic process No
GO:0044464 cell part No
GO:0018205 peptidyl-lysine modification No
GO:0018393 internal peptidyl-lysine acetylation No
GO:0006464 cellular protein modification process No
GO:0016043 cellular component organization No
GO:0006325 chromatin organization No
GO:0018193 peptidyl-amino acid modification No
GO:0018394 peptidyl-lysine acetylation No
GO:1902493 acetyltransferase complex No
GO:1901564 organonitrogen compound metabolic process No
GO:0006473 protein acetylation No
GO:0044267 cellular protein metabolic process No
GO:1902494 catalytic complex No
GO:0044237 cellular metabolic process No
GO:0019538 protein metabolic process No
GO:0044424 intracellular part No
GO:0044422 organelle part No
GO:0044451 nucleoplasm part No
GO:0043412 macromolecule modification No
GO:0044428 nuclear part No
GO:0006807 nitrogen compound metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0008150 biological_process No
GO:0032991 protein-containing complex No
GO:0008152 metabolic process No
GO:0005575 cellular_component No
GO:0043543 protein acylation No
GO:0031248 protein acetyltransferase complex No
GO:0006475 internal protein amino acid acetylation No
GO:0009987 cellular process No
GO:0071840 cellular component organization or biogenesis No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 27 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g1445.t1
MADTAPAPTAATATTGVAAPTAGATAGAPNAPADQNAASRGLPYYEKLRRELRDTLQKKRLMDKSMAQLEDQIFR
FEQSYLEETTAGNIIKGFDNYIKGSANGSSLGAAGLGLGSSMGGSRRKAQVTESDRVFSRSSASYMMDSPGPSSV
QTTPSHAATPTSTTGNGMSMKIDPLTVSAGMRNSNGASKNKKKATGGSKNTKGKNQTEDISDEDKPSVKRLKISY
GRD*
Coding >Pro_DTO377G3_2|g1445.t1
ATGGCCGACACAGCACCGGCTCCAACAGCCGCGACCGCGACCACCGGAGTTGCAGCGCCCACAGCCGGCGCAACA
GCAGGAGCACCGAATGCGCCCGCAGATCAGAATGCCGCGAGTCGCGGGCTACCTTACTACGAGAAACTGCGCCGC
GAGCTGCGGGACACGCTGCAGAAAAAGCGCTTAATGGATAAGAGCATGGCCCAACTCGAAGACCAAATCTTCCGC
TTCGAACAGTCATACCTGGAAGAAACGACCGCTGGAAACATCATCAAGGGCTTTGACAACTATATCAAAGGCTCT
GCGAATGGGTCGAGTCTCGGCGCCGCGGGACTGGGTCTGGGCAGCAGTATGGGCGGGTCGAGGCGAAAGGCGCAG
GTGACGGAATCGGATCGAGTTTTCTCGCGCAGCTCGGCGAGTTACATGATGGATTCCCCAGGTCCCTCCTCTGTA
CAAACCACGCCTTCCCACGCAGCAACGCCGACATCTACGACTGGAAACGGCATGTCCATGAAGATTGACCCGCTA
ACCGTTTCTGCCGGGATGAGGAACTCGAACGGCGCATCAAAAAACAAAAAGAAGGCGACTGGTGGGTCGAAGAAT
ACGAAGGGCAAGAACCAGACCGAGGATATTTCCGACGAGGACAAGCCTTCTGTGAAGCGGTTGAAGATCAGCTAC
GGCAGAGACTGA
Transcript >Pro_DTO377G3_2|g1445.t1
ATGGCCGACACAGCACCGGCTCCAACAGCCGCGACCGCGACCACCGGAGTTGCAGCGCCCACAGCCGGCGCAACA
GCAGGAGCACCGAATGCGCCCGCAGATCAGAATGCCGCGAGTCGCGGGCTACCTTACTACGAGAAACTGCGCCGC
GAGCTGCGGGACACGCTGCAGAAAAAGCGCTTAATGGATAAGAGCATGGCCCAACTCGAAGACCAAATCTTCCGC
TTCGAACAGTCATACCTGGAAGAAACGACCGCTGGAAACATCATCAAGGGCTTTGACAACTATATCAAAGGCTCT
GCGAATGGGTCGAGTCTCGGCGCCGCGGGACTGGGTCTGGGCAGCAGTATGGGCGGGTCGAGGCGAAAGGCGCAG
GTGACGGAATCGGATCGAGTTTTCTCGCGCAGCTCGGCGAGTTACATGATGGATTCCCCAGGTCCCTCCTCTGTA
CAAACCACGCCTTCCCACGCAGCAACGCCGACATCTACGACTGGAAACGGCATGTCCATGAAGATTGACCCGCTA
ACCGTTTCTGCCGGGATGAGGAACTCGAACGGCGCATCAAAAAACAAAAAGAAGGCGACTGGTGGGTCGAAGAAT
ACGAAGGGCAAGAACCAGACCGAGGATATTTCCGACGAGGACAAGCCTTCTGTGAAGCGGTTGAAGATCAGCTAC
GGCAGAGACTGA
Gene >Pro_DTO377G3_2|g1445.t1
ATGGCCGACACAGCACCGGCTCCAACAGCCGCGACCGCGACCACCGGAGTTGCAGCGCCCACAGCCGGCGCAACA
GCAGGAGCACCGAATGCGCCCGCAGATCAGAATGCCGCGAGTCGCGGGCTACCTTACTACGAGAAACTGCGCCGC
GAGCTGCGGGACACGCTGCAGAAAAAGCGCTTAATGGATAAGAGCATGGTGAGTTGCAGCCTTGCGCGTTCCCGT
CTCCAGGGACCGGGACGTGGTTACCTCTCTGGAATTTTGTTATTTCGCTGCGCGAGCATGTTTTCCAATTGAGAA
TCTGCAATATCGCCCTATGAATGTGTAAACCGTTCTGCTCTGATGTGTTTCTAACACACCTTTCCCCCAGGCCCA
ACTCGAAGACCAAATCTTCCGCTTCGAACAGTCATACCTGGAAGAAACGACCGCTGGAAACATCATCAAGGGCTT
TGACAACTATATCAAAGGCTCTGCGAATGGGTCGAGTCTCGGCGCCGCGGGACTGGGTCTGGGCAGCAGTATGGG
CGGGTCGAGGCGAAAGGCGCAGGTGACGGAATCGGATCGAGTTTTCTCGCGCAGCTCGGCGAGTTACATGATGGT
ATGCTGAACCGACCCGAAAATGGAACTACCATATGGTGTTTCTGATTTGAACTGAGGACTAACGATTATTGTTGT
GTCTGCAGGATTCCCCAGGTCCCTCCTCTGTACAAACCACGCCTTCCCACGCAGCAACGCCGACATCTACGACTG
GAAACGGCATGTCCATGAAGATTGACCCGCTAACCGTTTCTGCCGGGATGAGGAACTCGAACGGCGCATCAAAAA
ACAAAAAGAAGGCGACTGGTGGGTCGAAGAATACGAAGGGCAAGAACCAGACCGAGGATATTTCCGACGAGGACA
AGCCTTCTGTGAAGCGGTTGAAGATCAGCTACGGCAGAGACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail