Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g144.t1
Gene name
Locationscaffold_01:361246..362194
Strand+
Gene length (bp)948
Transcript length (bp)750
Coding sequence length (bp)750
Protein length (aa) 250

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 1.4E-11 15 83
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 5.3E-12 176 236

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0097159 organic cyclic compound binding No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0003676 nucleic acid binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 140.86 85.10 196.61
5d_25C Five days - 25 degrees Celsius 148.23 89.91 206.56
7d_25C Seven days - 25 degrees Celsius 144.84 87.63 202.05
10d_25C Ten days - 25 degrees Celsius 189.76 116.23 263.29
7d_15C Seven days - 15 degrees Celsius 141.00 84.53 197.46
7d_30C Seven days - 30 degrees Celsius 156.65 95.24 218.06

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.874448 no
3d_25C 7d_25C 0.935291 no
3d_25C 7d_15C 0.997772 no
3d_25C 7d_30C 0.711641 no
3d_25C 10d_25C 0.175287 no
5d_25C 7d_25C 0.947213 no
5d_25C 7d_15C 0.881577 no
5d_25C 7d_30C 0.865916 no
5d_25C 10d_25C 0.286918 no
7d_25C 7d_15C 0.940264 no
7d_25C 7d_30C 0.799150 no
7d_25C 10d_25C 0.228731 no
7d_15C 7d_30C 0.727167 no
7d_15C 10d_25C 0.189292 no
7d_30C 10d_25C 0.439725 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g144.t1
MAAVSAAGIPPNATVYVKNLDERIKLEQLKHALEEIFSEYGTILEVVAKTNLKAKGQAFIVFDNVESATRAIEDI
NGFDLFEKPMVLDYAKTPSDATVQREGGSEELEAHKRRRLAEKERKQAHEALEAQKKLKRPAAAVEPARPAKTTK
GAGLKPTAAATTAVVPDEYLPPNKILFLRELPEDATQEGLSAIFGRFEGFQEVRLVPGRKGIAFVEYEAEAGAIS
AKEATSGMPMGDQGKAIRVTYQRQ*
Coding >Pro_DTO377G3_2|g144.t1
ATGGCTGCCGTCTCAGCAGCTGGTATTCCCCCGAATGCGACAGTATATGTCAAGAATCTCGACGAGCGAATCAAG
CTTGAGCAGTTGAAGCATGCCCTGGAGGAGATCTTTTCCGAATATGGCACCATTCTAGAGGTCGTCGCAAAGACT
AACCTCAAAGCTAAGGGCCAGGCCTTCATCGTCTTTGACAACGTCGAATCCGCTACCCGCGCTATTGAGGATATC
AACGGCTTCGATCTCTTTGAGAAGCCTATGGTGCTGGATTATGCGAAGACACCTAGTGATGCGACAGTCCAGCGG
GAGGGTGGCAGCGAAGAGCTCGAGGCTCACAAGCGGAGACGCTTAGCTGAGAAAGAGCGCAAACAAGCCCACGAG
GCCCTCGAAGCACAGAAGAAACTCAAGCGTCCTGCTGCCGCCGTCGAACCCGCACGCCCAGCCAAGACCACCAAA
GGTGCCGGTCTCAAACCCACCGCTGCCGCTACCACCGCTGTCGTCCCAGACGAGTACCTCCCGCCCAACAAGATT
CTGTTCTTGCGGGAACTACCAGAAGACGCAACCCAGGAAGGTCTGTCTGCTATTTTTGGCCGGTTCGAAGGATTT
CAGGAAGTCAGATTGGTGCCTGGTCGCAAGGGAATTGCATTCGTGGAATACGAGGCCGAGGCTGGAGCAATCAGC
GCAAAGGAGGCTACATCAGGCATGCCCATGGGCGACCAGGGCAAGGCGATTCGCGTTACCTACCAGCGACAGTAG
Transcript >Pro_DTO377G3_2|g144.t1
ATGGCTGCCGTCTCAGCAGCTGGTATTCCCCCGAATGCGACAGTATATGTCAAGAATCTCGACGAGCGAATCAAG
CTTGAGCAGTTGAAGCATGCCCTGGAGGAGATCTTTTCCGAATATGGCACCATTCTAGAGGTCGTCGCAAAGACT
AACCTCAAAGCTAAGGGCCAGGCCTTCATCGTCTTTGACAACGTCGAATCCGCTACCCGCGCTATTGAGGATATC
AACGGCTTCGATCTCTTTGAGAAGCCTATGGTGCTGGATTATGCGAAGACACCTAGTGATGCGACAGTCCAGCGG
GAGGGTGGCAGCGAAGAGCTCGAGGCTCACAAGCGGAGACGCTTAGCTGAGAAAGAGCGCAAACAAGCCCACGAG
GCCCTCGAAGCACAGAAGAAACTCAAGCGTCCTGCTGCCGCCGTCGAACCCGCACGCCCAGCCAAGACCACCAAA
GGTGCCGGTCTCAAACCCACCGCTGCCGCTACCACCGCTGTCGTCCCAGACGAGTACCTCCCGCCCAACAAGATT
CTGTTCTTGCGGGAACTACCAGAAGACGCAACCCAGGAAGGTCTGTCTGCTATTTTTGGCCGGTTCGAAGGATTT
CAGGAAGTCAGATTGGTGCCTGGTCGCAAGGGAATTGCATTCGTGGAATACGAGGCCGAGGCTGGAGCAATCAGC
GCAAAGGAGGCTACATCAGGCATGCCCATGGGCGACCAGGGCAAGGCGATTCGCGTTACCTACCAGCGACAGTAG
Gene >Pro_DTO377G3_2|g144.t1
ATGGCTGCCGTCTCAGCAGCTGGTATTCCCCCGAATGCGACGTGAGTACTATATCTACATGCTATGTCCCCATGC
TAACAAGTCTTCACAGAGTATATGTGCGCCTGTCCCTCCCCTCCATCATATCACCACTCCGCTCCCGCATTACCA
TACTGACCGATTGCTTCCCCCTATTAGGTCAAGAATCTCGACGAGCGAATCAAGCTTGAGCAGTTGAAGCATGCC
CTGGAGGAGATCTTTTCCGAATATGGCACCATTCTAGAGGTCGTCGCAAAGACTAACCTCAAAGCTAAGGGCCAG
GCCTTCATCGTCTTTGACAACGTCGAATCCGCTACCCGCGCTATTGAGGATATCAACGGCTTCGATCTCTTTGAG
AAGCCTATGGTGCTGGATTATGCGAAGACACCTAGTGATGCGACAGTCCAGCGGGAGGGTGGCAGCGAAGAGCTC
GAGGCTCACAAGCGGAGACGCTTAGCTGAGAAAGGTACGTTTAACAGATACCGGCGCACTAAATACAAATACTCA
ATCCGTACTAATGATTGTCGTTTTACAGAGCGCAAACAAGCCCACGAGGCCCTCGAAGCACAGAAGAAACTCAAG
CGTCCTGCTGCCGCCGTCGAACCCGCACGCCCAGCCAAGACCACCAAAGGTGCCGGTCTCAAACCCACCGCTGCC
GCTACCACCGCTGTCGTCCCAGACGAGTACCTCCCGCCCAACAAGATTCTGTTCTTGCGGGAACTACCAGAAGAC
GCAACCCAGGAAGGTCTGTCTGCTATTTTTGGCCGGTTCGAAGGATTTCAGGAAGTCAGATTGGTGCCTGGTCGC
AAGGGAATTGCATTCGTGGAATACGAGGCCGAGGCTGGAGCAATCAGCGCAAAGGAGGCTACATCAGGCATGCCC
ATGGGCGACCAGGGCAAGGCGATTCGCGTTACCTACCAGCGACAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail