Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g1437.t1
Gene name
Locationscaffold_01:3791845..3793194
Strand-
Gene length (bp)1349
Transcript length (bp)1296
Coding sequence length (bp)1296
Protein length (aa) 432

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13813 MBOAT_2 Membrane bound O-acyl transferase family 2.7E-24 239 324

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 28 0.45

Transmembrane Domains

Domain # Start End Length
1 10 32 22
2 294 316 22
3 368 385 17
4 406 428 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 12.12 5.19 19.05
5d_25C Five days - 25 degrees Celsius 13.21 5.84 20.58
7d_25C Seven days - 25 degrees Celsius 15.84 7.37 24.30
10d_25C Ten days - 25 degrees Celsius 16.07 7.34 24.80
7d_15C Seven days - 15 degrees Celsius 5.65 1.84 9.47
7d_30C Seven days - 30 degrees Celsius 19.73 9.70 29.76

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.844621 no
3d_25C 7d_25C 0.437468 no
3d_25C 7d_15C 0.023673 yes
3d_25C 7d_30C 0.092657 no
3d_25C 10d_25C 0.412335 no
5d_25C 7d_25C 0.634490 no
5d_25C 7d_15C 0.009770 yes
5d_25C 7d_30C 0.189796 no
5d_25C 10d_25C 0.602804 no
7d_25C 7d_15C 0.001278 yes
7d_25C 7d_30C 0.513781 no
7d_25C 10d_25C 0.976321 no
7d_15C 7d_30C 0.000700 yes
7d_15C 10d_25C 0.000700 yes
7d_30C 10d_25C 0.554242 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g1437.t1
MYGLYHSTGANILEFFCSYLVQNVVPAALIITTRKGSLLRYLCIPGMIWIASRFIRPFGSSGSPTWCQAITQFVI
ATLQATNLLLLNPLVNSDISRDAKSTRKSGSKLLAASRLLTQTRAVNTHWQVKNVPSHPKYYLRRGMQVPTWGRF
LLRQLAIVAWQCLVLDIVQTVSIQQARERGLYEPASLEVKWIVPVGQWAERIATHLSIWFIVNRLIGDLAYRVLS
IFFVGIGLDSPADWPPAFGSMADAFTLRNFWGKFWHQFMRQPFTSISNFIARDFLHLTRSSMLERYTNIFIVFLI
SAMFHVMVDILQSVPMERSGSMPFYLSFVFGIMLEDGVQNIWQRVQAPENWQEVKQSSGIVPLWKRAVGMVWVML
WLGITSTWYFTPMIQSTNDDLRVIPFSVARYIGLQPLIGIVLGSGIGIALMFEVEL*
Coding >Pro_DTO377G3_2|g1437.t1
ATGTACGGGCTATATCACTCAACAGGTGCAAACATATTAGAATTCTTCTGTTCCTACCTAGTTCAGAATGTGGTT
CCTGCTGCGCTCATCATCACCACACGGAAAGGCTCTCTTTTACGCTACCTATGCATTCCAGGGATGATATGGATC
GCCAGCCGTTTTATCCGTCCTTTTGGCTCGTCCGGCAGTCCAACATGGTGCCAGGCCATAACACAATTTGTCATT
GCAACTTTACAGGCAACAAACCTGTTGTTGCTTAATCCTCTAGTCAATTCAGACATCTCGCGCGACGCAAAGAGC
ACTCGAAAGTCCGGGTCTAAGTTGCTCGCAGCATCTCGCTTACTTACTCAAACCCGTGCCGTCAATACACACTGG
CAGGTGAAGAATGTGCCCTCTCATCCAAAGTATTATCTGCGGCGGGGTATGCAGGTCCCAACATGGGGTCGATTT
TTGCTGCGACAGCTAGCAATCGTCGCATGGCAGTGCCTAGTGCTAGACATCGTGCAAACGGTCTCGATTCAGCAG
GCTAGGGAACGTGGTCTGTATGAGCCCGCATCCTTGGAGGTCAAATGGATTGTGCCGGTCGGACAATGGGCAGAG
CGAATAGCCACGCATCTGTCTATTTGGTTTATAGTAAACCGTCTAATCGGTGATCTTGCATATCGAGTACTGTCG
ATATTTTTCGTTGGAATCGGGCTAGATTCCCCTGCAGACTGGCCACCAGCCTTTGGGAGTATGGCCGATGCATTT
ACATTGCGCAACTTTTGGGGGAAATTCTGGCATCAATTCATGCGTCAGCCCTTCACTTCTATCAGTAACTTCATC
GCGCGAGATTTTTTGCATCTTACCCGATCTTCAATGCTGGAGCGATACACCAACATTTTCATTGTCTTTCTTATC
TCCGCAATGTTCCATGTCATGGTTGATATACTGCAGAGCGTTCCGATGGAAAGATCCGGCTCAATGCCATTCTAC
TTATCGTTTGTCTTTGGGATAATGCTCGAGGATGGCGTGCAAAATATTTGGCAACGGGTACAAGCACCAGAGAAC
TGGCAAGAGGTAAAGCAATCATCAGGTATTGTCCCGCTTTGGAAGAGAGCCGTTGGAATGGTATGGGTCATGTTA
TGGCTTGGGATCACCTCGACATGGTACTTTACTCCAATGATTCAATCCACGAATGATGATCTGCGGGTGATTCCT
TTCAGTGTCGCAAGATATATCGGCCTCCAGCCACTCATAGGTATTGTCCTGGGTAGTGGAATTGGCATTGCACTT
ATGTTTGAAGTTGAGCTATGA
Transcript >Pro_DTO377G3_2|g1437.t1
ATGTACGGGCTATATCACTCAACAGGTGCAAACATATTAGAATTCTTCTGTTCCTACCTAGTTCAGAATGTGGTT
CCTGCTGCGCTCATCATCACCACACGGAAAGGCTCTCTTTTACGCTACCTATGCATTCCAGGGATGATATGGATC
GCCAGCCGTTTTATCCGTCCTTTTGGCTCGTCCGGCAGTCCAACATGGTGCCAGGCCATAACACAATTTGTCATT
GCAACTTTACAGGCAACAAACCTGTTGTTGCTTAATCCTCTAGTCAATTCAGACATCTCGCGCGACGCAAAGAGC
ACTCGAAAGTCCGGGTCTAAGTTGCTCGCAGCATCTCGCTTACTTACTCAAACCCGTGCCGTCAATACACACTGG
CAGGTGAAGAATGTGCCCTCTCATCCAAAGTATTATCTGCGGCGGGGTATGCAGGTCCCAACATGGGGTCGATTT
TTGCTGCGACAGCTAGCAATCGTCGCATGGCAGTGCCTAGTGCTAGACATCGTGCAAACGGTCTCGATTCAGCAG
GCTAGGGAACGTGGTCTGTATGAGCCCGCATCCTTGGAGGTCAAATGGATTGTGCCGGTCGGACAATGGGCAGAG
CGAATAGCCACGCATCTGTCTATTTGGTTTATAGTAAACCGTCTAATCGGTGATCTTGCATATCGAGTACTGTCG
ATATTTTTCGTTGGAATCGGGCTAGATTCCCCTGCAGACTGGCCACCAGCCTTTGGGAGTATGGCCGATGCATTT
ACATTGCGCAACTTTTGGGGGAAATTCTGGCATCAATTCATGCGTCAGCCCTTCACTTCTATCAGTAACTTCATC
GCGCGAGATTTTTTGCATCTTACCCGATCTTCAATGCTGGAGCGATACACCAACATTTTCATTGTCTTTCTTATC
TCCGCAATGTTCCATGTCATGGTTGATATACTGCAGAGCGTTCCGATGGAAAGATCCGGCTCAATGCCATTCTAC
TTATCGTTTGTCTTTGGGATAATGCTCGAGGATGGCGTGCAAAATATTTGGCAACGGGTACAAGCACCAGAGAAC
TGGCAAGAGGTAAAGCAATCATCAGGTATTGTCCCGCTTTGGAAGAGAGCCGTTGGAATGGTATGGGTCATGTTA
TGGCTTGGGATCACCTCGACATGGTACTTTACTCCAATGATTCAATCCACGAATGATGATCTGCGGGTGATTCCT
TTCAGTGTCGCAAGATATATCGGCCTCCAGCCACTCATAGGTATTGTCCTGGGTAGTGGAATTGGCATTGCACTT
ATGTTTGAAGTTGAGCTATGA
Gene >Pro_DTO377G3_2|g1437.t1
ATGTACGGGCTATATCACTCAACAGGTGCAAACATATTAGAATTCTTCTGTTCCTACCTAGTTCAGAATGTGGTT
CCTGCTGCGCTCATCATCACCACACGGAAAGGCTCTCTTTTACGCTACCTATGCATTCCAGGGATGATATGGATC
GCCAGCCGTTTTATCCGTCCTTTTGGCTCGTCCGGCAGTCCAACATGGTGCCAGGCCATAACACAATTTGTCATT
GCAACTTTACAGGCAACAAACCTGTTGTTGCTTAATCCTCTAGTCAATTCAGACATCTCGCGCGACGCAAAGAGC
ACTCGAAAGTCCGGGTCTAAGTTGCTCGCAGCATCTCGCTTACTTACTCAAACCCGTGCCGTCAATACACACTGG
CAGGTGAAGAATGTGCCCTCTCATCCAAAGTATTATCTGCGGCGGGGTATGCAGGTCCCAACATGGGGTCGATTT
TTGCTGCGACAGCTAGCAATCGTCGCATGGCAGTGCCTAGTGCTAGACATCGTGCAAACGGTCTCGATTCAGCAG
GCTAGGGAACGTGGTCTGTATGAGCCCGCATCCTTGGAGGTCAAATGGATTGTGCCGGTCGGACAATGGGCAGAG
CGAATAGCCACGCATCTGTCTATTTGGTTTATAGTAAACCGTCTAATCGGTGATCTTGCATATCGAGTACTGTCG
ATATTTTTCGTTGGAATCGGGCTAGATTCCCCTGCAGACTGGCCACCAGCCTTTGGGAGTATGGCCGATGCATTT
ACATTGCGCAACTTTTGGGGGTAAGCCATATTTATTTACTAGGATGGCATGATTATGTTAACGTATTTCACAGGA
AATTCTGGCATCAATTCATGCGTCAGCCCTTCACTTCTATCAGTAACTTCATCGCGCGAGATTTTTTGCATCTTA
CCCGATCTTCAATGCTGGAGCGATACACCAACATTTTCATTGTCTTTCTTATCTCCGCAATGTTCCATGTCATGG
TTGATATACTGCAGAGCGTTCCGATGGAAAGATCCGGCTCAATGCCATTCTACTTATCGTTTGTCTTTGGGATAA
TGCTCGAGGATGGCGTGCAAAATATTTGGCAACGGGTACAAGCACCAGAGAACTGGCAAGAGGTAAAGCAATCAT
CAGGTATTGTCCCGCTTTGGAAGAGAGCCGTTGGAATGGTATGGGTCATGTTATGGCTTGGGATCACCTCGACAT
GGTACTTTACTCCAATGATTCAATCCACGAATGATGATCTGCGGGTGATTCCTTTCAGTGTCGCAAGATATATCG
GCCTCCAGCCACTCATAGGTATTGTCCTGGGTAGTGGAATTGGCATTGCACTTATGTTTGAAGTTGAGCTATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail