Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g1435.t1
Gene name
Locationscaffold_01:3784694..3787127
Strand-
Gene length (bp)2433
Transcript length (bp)2433
Coding sequence length (bp)2433
Protein length (aa) 811

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 7.19 3.18 11.20
5d_25C Five days - 25 degrees Celsius 6.31 2.69 9.94
7d_25C Seven days - 25 degrees Celsius 6.91 3.02 10.80
10d_25C Ten days - 25 degrees Celsius 6.97 3.07 10.88
7d_15C Seven days - 15 degrees Celsius 4.45 1.68 7.21
7d_30C Seven days - 30 degrees Celsius 9.05 4.22 13.89

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.762784 no
3d_25C 7d_25C 0.933003 no
3d_25C 7d_15C 0.142247 no
3d_25C 7d_30C 0.525663 no
3d_25C 10d_25C 0.951497 no
5d_25C 7d_25C 0.843130 no
5d_25C 7d_15C 0.331134 no
5d_25C 7d_30C 0.282443 no
5d_25C 10d_25C 0.826364 no
7d_25C 7d_15C 0.182017 no
7d_25C 7d_30C 0.438835 no
7d_25C 10d_25C 0.985822 no
7d_15C 7d_30C 0.020660 yes
7d_15C 10d_25C 0.178456 no
7d_30C 10d_25C 0.462051 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g1435.t1
MRSSLVMLAGLASSALAYPTDRAVEARNLDLLGELLGDLTLDVTGILSTVLEGTSVEIFAGLSAQGAAALSGGAL
GCKAGAIHAKAKAALKVWLRLHAEIDTTLKTSLIAWCDGHDELVLSADVLAALSVYIPGSANIAAKGQLYVTIDG
IFEAASLESALVLSVAAQTSLSAWVEAKVDLDVDIKVGLNVCAAGGIVGSLSADIKASLLAWLNSTECELSADLK
VSVLAWINGRAGGELVEIGALADTALSTVSVGASVGIHVLESGLLSVGGQASLAAFLGVDLAVALGADVKLALEA
CAKGELATAVELDVRTKLAIWLASSDCSLGVELKAVVLLWLSFAVEADVSVALNLVDGVLGDVTGLLTDIVDDLS
VDLRGALSLCAAGGSLLDLTFSARTELAAFLSGCTSLNIDVSIQIIIIEWFTGCSIPGAPAATASSSVLSLPSST
PYVASTSSVPSGASASVGLTVSASVPAASGSVSVPSGSDATSTPCATETSEIVSSTVIPNPSGSGSLTASIPAIA
TGTVPAVVPTGASPTGTTVSGSVPAGSATTGTATTVVIPGSSGSSATTVTIPVTVTGTAPSGSATTIVVPNPSGT
SSLTVTIPAQATGVSPTGTTVVGGSVPSGSAPSASTTTVVIPGSSGSSSTTVTVTVPAEATGVSPTGTTVVGGSV
PSGSAPSASTTTVVIPGSSGSSSTTITVTVPAEATSTAPSGSATTIVVPHPSGTGSLTVTVPAQATGTAATTGAS
GVTASAPAPTSPATIPSGGSTGSNVTETVTVTATLPSGGNTGSGKATETVTVTATVCGCE*
Coding >Pro_DTO377G3_2|g1435.t1
ATGCGTTCTTCACTTGTTATGCTCGCCGGTCTGGCCAGCTCGGCTCTCGCCTACCCTACCGATAGGGCTGTGGAG
GCCCGTAACCTCGATCTCCTCGGTGAGCTCCTCGGCGACCTCACCCTCGACGTGACTGGTATCCTTAGTACCGTC
CTCGAAGGCACCTCCGTTGAGATCTTCGCTGGTCTGAGTGCCCAGGGTGCTGCCGCTCTCTCGGGTGGTGCTCTC
GGCTGCAAGGCCGGTGCCATCCACGCAAAGGCCAAGGCCGCCCTCAAGGTTTGGCTGCGTCTCCACGCCGAGATT
GACACCACCCTCAAGACCTCCCTGATCGCCTGGTGTGACGGTCATGACGAGCTAGTCCTCTCCGCCGACGTCCTC
GCTGCTCTGTCCGTCTACATCCCCGGATCTGCCAACATCGCCGCCAAGGGTCAGCTTTACGTGACTATCGACGGT
ATCTTCGAGGCCGCCAGCCTCGAGTCTGCTCTTGTCTTGAGCGTTGCTGCTCAGACTTCCCTCTCCGCTTGGGTT
GAGGCTAAGGTTGACCTTGATGTCGACATCAAGGTCGGTCTGAATGTCTGCGCCGCTGGTGGTATTGTCGGCAGT
CTGTCGGCTGACATCAAGGCTTCCCTGCTTGCTTGGCTCAACAGCACCGAGTGTGAGCTCAGCGCTGACCTCAAG
GTTTCGGTCCTTGCCTGGATCAATGGCCGTGCTGGTGGTGAACTTGTTGAGATTGGTGCTCTTGCTGACACTGCT
CTCTCCACCGTCTCCGTTGGTGCCTCCGTTGGCATCCACGTCCTAGAGTCTGGCCTCCTGTCCGTTGGCGGTCAG
GCCTCCCTCGCCGCCTTCCTGGGCGTTGATCTCGCCGTTGCTCTCGGTGCTGATGTCAAGCTCGCTCTCGAGGCA
TGCGCCAAGGGCGAACTCGCCACCGCTGTGGAACTTGACGTCCGCACCAAGCTCGCCATCTGGCTCGCCAGCTCC
GACTGCTCTCTGGGCGTTGAACTCAAGGCTGTCGTCCTTCTTTGGCTCTCCTTCGCTGTCGAGGCTGATGTCTCC
GTTGCGCTCAATCTTGTTGATGGTGTCCTCGGTGATGTTACTGGTCTCCTGACCGATATCGTCGACGATCTCAGC
GTCGACCTCCGTGGTGCCCTTTCCCTCTGCGCTGCCGGCGGTAGCCTCCTCGACCTGACCTTCAGCGCCCGTACT
GAGCTCGCTGCCTTCCTCAGTGGCTGCACTTCCCTCAACATCGACGTCAGCATCCAGATCATTATCATCGAGTGG
TTCACCGGCTGCAGCATCCCCGGCGCCCCCGCCGCCACTGCCTCGTCTTCCGTCCTCAGCCTGCCCTCCAGCACC
CCCTACGTCGCCAGCACCTCCTCCGTGCCTTCCGGTGCCAGTGCCTCCGTTGGTCTGACTGTTTCCGCCAGTGTT
CCCGCCGCCTCCGGCTCTGTCTCTGTTCCCTCCGGTTCCGATGCCACCAGCACCCCCTGTGCCACCGAGACCTCG
GAAATTGTCAGCTCGACTGTGATCCCCAACCCTAGCGGCTCCGGTTCTCTCACTGCCTCTATCCCTGCCATCGCC
ACCGGTACTGTCCCTGCTGTGGTCCCCACCGGCGCTTCCCCTACCGGCACTACCGTCAGTGGTTCCGTTCCTGCT
GGATCTGCCACTACCGGAACCGCTACCACCGTTGTCATCCCCGGCTCCAGCGGCTCCAGCGCCACCACTGTCACC
ATCCCCGTCACAGTCACCGGCACTGCCCCTAGCGGTTCTGCTACCACCATTGTGGTCCCCAACCCCAGCGGCACC
TCTTCTCTCACTGTCACCATCCCTGCCCAGGCTACCGGCGTTTCCCCCACCGGTACCACCGTCGTCGGTGGCTCC
GTTCCTTCTGGATCTGCCCCTAGTGCCTCGACCACCACCGTTGTGATCCCCGGCTCCAGCGGCTCCAGCTCCACC
ACCGTCACCGTCACCGTCCCTGCCGAGGCTACCGGCGTTTCCCCCACCGGTACCACCGTTGTCGGTGGCTCTGTT
CCTTCTGGATCTGCCCCTAGTGCCTCGACCACCACTGTTGTGATCCCCGGCTCCAGCGGCTCCAGCTCCACCACC
ATCACCGTCACCGTCCCTGCCGAGGCTACCAGCACTGCCCCTAGCGGTTCCGCCACCACCATCGTGGTCCCCCAC
CCCAGCGGCACCGGCTCTCTGACCGTCACCGTCCCTGCCCAGGCTACCGGCACCGCTGCTACCACTGGTGCTTCC
GGCGTCACTGCATCGGCCCCTGCCCCTACCAGCCCTGCCACCATCCCCAGCGGTGGAAGCACTGGTTCCAATGTC
ACCGAGACTGTCACTGTTACCGCCACCCTTCCCTCCGGCGGTAACACTGGCTCCGGCAAGGCCACTGAGACCGTG
ACTGTCACTGCCACCGTCTGCGGCTGCGAGTAA
Transcript >Pro_DTO377G3_2|g1435.t1
ATGCGTTCTTCACTTGTTATGCTCGCCGGTCTGGCCAGCTCGGCTCTCGCCTACCCTACCGATAGGGCTGTGGAG
GCCCGTAACCTCGATCTCCTCGGTGAGCTCCTCGGCGACCTCACCCTCGACGTGACTGGTATCCTTAGTACCGTC
CTCGAAGGCACCTCCGTTGAGATCTTCGCTGGTCTGAGTGCCCAGGGTGCTGCCGCTCTCTCGGGTGGTGCTCTC
GGCTGCAAGGCCGGTGCCATCCACGCAAAGGCCAAGGCCGCCCTCAAGGTTTGGCTGCGTCTCCACGCCGAGATT
GACACCACCCTCAAGACCTCCCTGATCGCCTGGTGTGACGGTCATGACGAGCTAGTCCTCTCCGCCGACGTCCTC
GCTGCTCTGTCCGTCTACATCCCCGGATCTGCCAACATCGCCGCCAAGGGTCAGCTTTACGTGACTATCGACGGT
ATCTTCGAGGCCGCCAGCCTCGAGTCTGCTCTTGTCTTGAGCGTTGCTGCTCAGACTTCCCTCTCCGCTTGGGTT
GAGGCTAAGGTTGACCTTGATGTCGACATCAAGGTCGGTCTGAATGTCTGCGCCGCTGGTGGTATTGTCGGCAGT
CTGTCGGCTGACATCAAGGCTTCCCTGCTTGCTTGGCTCAACAGCACCGAGTGTGAGCTCAGCGCTGACCTCAAG
GTTTCGGTCCTTGCCTGGATCAATGGCCGTGCTGGTGGTGAACTTGTTGAGATTGGTGCTCTTGCTGACACTGCT
CTCTCCACCGTCTCCGTTGGTGCCTCCGTTGGCATCCACGTCCTAGAGTCTGGCCTCCTGTCCGTTGGCGGTCAG
GCCTCCCTCGCCGCCTTCCTGGGCGTTGATCTCGCCGTTGCTCTCGGTGCTGATGTCAAGCTCGCTCTCGAGGCA
TGCGCCAAGGGCGAACTCGCCACCGCTGTGGAACTTGACGTCCGCACCAAGCTCGCCATCTGGCTCGCCAGCTCC
GACTGCTCTCTGGGCGTTGAACTCAAGGCTGTCGTCCTTCTTTGGCTCTCCTTCGCTGTCGAGGCTGATGTCTCC
GTTGCGCTCAATCTTGTTGATGGTGTCCTCGGTGATGTTACTGGTCTCCTGACCGATATCGTCGACGATCTCAGC
GTCGACCTCCGTGGTGCCCTTTCCCTCTGCGCTGCCGGCGGTAGCCTCCTCGACCTGACCTTCAGCGCCCGTACT
GAGCTCGCTGCCTTCCTCAGTGGCTGCACTTCCCTCAACATCGACGTCAGCATCCAGATCATTATCATCGAGTGG
TTCACCGGCTGCAGCATCCCCGGCGCCCCCGCCGCCACTGCCTCGTCTTCCGTCCTCAGCCTGCCCTCCAGCACC
CCCTACGTCGCCAGCACCTCCTCCGTGCCTTCCGGTGCCAGTGCCTCCGTTGGTCTGACTGTTTCCGCCAGTGTT
CCCGCCGCCTCCGGCTCTGTCTCTGTTCCCTCCGGTTCCGATGCCACCAGCACCCCCTGTGCCACCGAGACCTCG
GAAATTGTCAGCTCGACTGTGATCCCCAACCCTAGCGGCTCCGGTTCTCTCACTGCCTCTATCCCTGCCATCGCC
ACCGGTACTGTCCCTGCTGTGGTCCCCACCGGCGCTTCCCCTACCGGCACTACCGTCAGTGGTTCCGTTCCTGCT
GGATCTGCCACTACCGGAACCGCTACCACCGTTGTCATCCCCGGCTCCAGCGGCTCCAGCGCCACCACTGTCACC
ATCCCCGTCACAGTCACCGGCACTGCCCCTAGCGGTTCTGCTACCACCATTGTGGTCCCCAACCCCAGCGGCACC
TCTTCTCTCACTGTCACCATCCCTGCCCAGGCTACCGGCGTTTCCCCCACCGGTACCACCGTCGTCGGTGGCTCC
GTTCCTTCTGGATCTGCCCCTAGTGCCTCGACCACCACCGTTGTGATCCCCGGCTCCAGCGGCTCCAGCTCCACC
ACCGTCACCGTCACCGTCCCTGCCGAGGCTACCGGCGTTTCCCCCACCGGTACCACCGTTGTCGGTGGCTCTGTT
CCTTCTGGATCTGCCCCTAGTGCCTCGACCACCACTGTTGTGATCCCCGGCTCCAGCGGCTCCAGCTCCACCACC
ATCACCGTCACCGTCCCTGCCGAGGCTACCAGCACTGCCCCTAGCGGTTCCGCCACCACCATCGTGGTCCCCCAC
CCCAGCGGCACCGGCTCTCTGACCGTCACCGTCCCTGCCCAGGCTACCGGCACCGCTGCTACCACTGGTGCTTCC
GGCGTCACTGCATCGGCCCCTGCCCCTACCAGCCCTGCCACCATCCCCAGCGGTGGAAGCACTGGTTCCAATGTC
ACCGAGACTGTCACTGTTACCGCCACCCTTCCCTCCGGCGGTAACACTGGCTCCGGCAAGGCCACTGAGACCGTG
ACTGTCACTGCCACCGTCTGCGGCTGCGAGTAA
Gene >Pro_DTO377G3_2|g1435.t1
ATGCGTTCTTCACTTGTTATGCTCGCCGGTCTGGCCAGCTCGGCTCTCGCCTACCCTACCGATAGGGCTGTGGAG
GCCCGTAACCTCGATCTCCTCGGTGAGCTCCTCGGCGACCTCACCCTCGACGTGACTGGTATCCTTAGTACCGTC
CTCGAAGGCACCTCCGTTGAGATCTTCGCTGGTCTGAGTGCCCAGGGTGCTGCCGCTCTCTCGGGTGGTGCTCTC
GGCTGCAAGGCCGGTGCCATCCACGCAAAGGCCAAGGCCGCCCTCAAGGTTTGGCTGCGTCTCCACGCCGAGATT
GACACCACCCTCAAGACCTCCCTGATCGCCTGGTGTGACGGTCATGACGAGCTAGTCCTCTCCGCCGACGTCCTC
GCTGCTCTGTCCGTCTACATCCCCGGATCTGCCAACATCGCCGCCAAGGGTCAGCTTTACGTGACTATCGACGGT
ATCTTCGAGGCCGCCAGCCTCGAGTCTGCTCTTGTCTTGAGCGTTGCTGCTCAGACTTCCCTCTCCGCTTGGGTT
GAGGCTAAGGTTGACCTTGATGTCGACATCAAGGTCGGTCTGAATGTCTGCGCCGCTGGTGGTATTGTCGGCAGT
CTGTCGGCTGACATCAAGGCTTCCCTGCTTGCTTGGCTCAACAGCACCGAGTGTGAGCTCAGCGCTGACCTCAAG
GTTTCGGTCCTTGCCTGGATCAATGGCCGTGCTGGTGGTGAACTTGTTGAGATTGGTGCTCTTGCTGACACTGCT
CTCTCCACCGTCTCCGTTGGTGCCTCCGTTGGCATCCACGTCCTAGAGTCTGGCCTCCTGTCCGTTGGCGGTCAG
GCCTCCCTCGCCGCCTTCCTGGGCGTTGATCTCGCCGTTGCTCTCGGTGCTGATGTCAAGCTCGCTCTCGAGGCA
TGCGCCAAGGGCGAACTCGCCACCGCTGTGGAACTTGACGTCCGCACCAAGCTCGCCATCTGGCTCGCCAGCTCC
GACTGCTCTCTGGGCGTTGAACTCAAGGCTGTCGTCCTTCTTTGGCTCTCCTTCGCTGTCGAGGCTGATGTCTCC
GTTGCGCTCAATCTTGTTGATGGTGTCCTCGGTGATGTTACTGGTCTCCTGACCGATATCGTCGACGATCTCAGC
GTCGACCTCCGTGGTGCCCTTTCCCTCTGCGCTGCCGGCGGTAGCCTCCTCGACCTGACCTTCAGCGCCCGTACT
GAGCTCGCTGCCTTCCTCAGTGGCTGCACTTCCCTCAACATCGACGTCAGCATCCAGATCATTATCATCGAGTGG
TTCACCGGCTGCAGCATCCCCGGCGCCCCCGCCGCCACTGCCTCGTCTTCCGTCCTCAGCCTGCCCTCCAGCACC
CCCTACGTCGCCAGCACCTCCTCCGTGCCTTCCGGTGCCAGTGCCTCCGTTGGTCTGACTGTTTCCGCCAGTGTT
CCCGCCGCCTCCGGCTCTGTCTCTGTTCCCTCCGGTTCCGATGCCACCAGCACCCCCTGTGCCACCGAGACCTCG
GAAATTGTCAGCTCGACTGTGATCCCCAACCCTAGCGGCTCCGGTTCTCTCACTGCCTCTATCCCTGCCATCGCC
ACCGGTACTGTCCCTGCTGTGGTCCCCACCGGCGCTTCCCCTACCGGCACTACCGTCAGTGGTTCCGTTCCTGCT
GGATCTGCCACTACCGGAACCGCTACCACCGTTGTCATCCCCGGCTCCAGCGGCTCCAGCGCCACCACTGTCACC
ATCCCCGTCACAGTCACCGGCACTGCCCCTAGCGGTTCTGCTACCACCATTGTGGTCCCCAACCCCAGCGGCACC
TCTTCTCTCACTGTCACCATCCCTGCCCAGGCTACCGGCGTTTCCCCCACCGGTACCACCGTCGTCGGTGGCTCC
GTTCCTTCTGGATCTGCCCCTAGTGCCTCGACCACCACCGTTGTGATCCCCGGCTCCAGCGGCTCCAGCTCCACC
ACCGTCACCGTCACCGTCCCTGCCGAGGCTACCGGCGTTTCCCCCACCGGTACCACCGTTGTCGGTGGCTCTGTT
CCTTCTGGATCTGCCCCTAGTGCCTCGACCACCACTGTTGTGATCCCCGGCTCCAGCGGCTCCAGCTCCACCACC
ATCACCGTCACCGTCCCTGCCGAGGCTACCAGCACTGCCCCTAGCGGTTCCGCCACCACCATCGTGGTCCCCCAC
CCCAGCGGCACCGGCTCTCTGACCGTCACCGTCCCTGCCCAGGCTACCGGCACCGCTGCTACCACTGGTGCTTCC
GGCGTCACTGCATCGGCCCCTGCCCCTACCAGCCCTGCCACCATCCCCAGCGGTGGAAGCACTGGTTCCAATGTC
ACCGAGACTGTCACTGTTACCGCCACCCTTCCCTCCGGCGGTAACACTGGCTCCGGCAAGGCCACTGAGACCGTG
ACTGTCACTGCCACCGTCTGCGGCTGCGAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail