Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g1434.t1
Gene name
Locationscaffold_01:3782359..3784108
Strand+
Gene length (bp)1749
Transcript length (bp)1401
Coding sequence length (bp)1401
Protein length (aa) 467

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01480 PWI PWI domain 1.7E-29 31 101

GO

GO Term Description Terminal node
GO:0006397 mRNA processing Yes
GO:0090304 nucleic acid metabolic process No
GO:0071704 organic substance metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0016071 mRNA metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0016070 RNA metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0008152 metabolic process No
GO:0044237 cellular metabolic process No
GO:0009987 cellular process No
GO:0008150 biological_process No
GO:0044238 primary metabolic process No
GO:0006396 RNA processing No
GO:0006725 cellular aromatic compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 68 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g1434.t1
MASSVDAKLMRRTKFPPEFSKKVDMTKVNIEVMKKWIASQISKILGNEDDVVIELCFAHLEGARYPDIKSLQIQL
TGFLDKDTAKFCQELWSLCLSGQANPQGVPKELLEAKKLELIQEKLEAEKASEALRRRREQDQNRERELDDVRRR
ERPDRGRGGRGGDRGDRGGRGGRGRDFNRRFSPPRDRNRSRDRFREPPLRRDLDSYVPPGNRRRRSSRSPHGTRS
PSGTPKPSSPSRRNRDEPHHRRRERPSISVSPERRRGGARRRSSPDYGDRVKARPISRSRSPRSRSPRGNRRRSS
VSRSRSVSRSRSRRPSGRYARHDSRRLSRSRSRSRSRTPDRTGTRDRGENRRRRSPSGDRRLSRSRSNSPKKDTD
GKRPLSVERDNPDDKRRKMADENEVSSTRTPPKADEPPKTDDNSFLFNTKKPLSVWTQSTAFREKLLRERCIAMR
RQAAQKPSSASQPKQD*
Coding >Pro_DTO377G3_2|g1434.t1
ATGGCGTCCAGCGTAGATGCCAAGCTGATGAGGCGGACTAAGTTCCCCCCTGAGTTCAGCAAGAAGGTAGATATG
ACCAAGGTCAATATCGAAGTTATGAAGAAATGGATTGCAAGTCAAATCTCCAAGATATTGGGGAACGAGGATGAC
GTCGTTATCGAGCTCTGCTTCGCGCATCTTGAGGGGGCACGCTACCCCGATATTAAATCTCTCCAAATCCAACTC
ACCGGATTTCTAGACAAAGATACCGCCAAGTTCTGTCAGGAGCTGTGGTCGCTGTGCCTAAGCGGTCAGGCCAAT
CCACAGGGCGTCCCGAAGGAACTCCTGGAAGCCAAAAAGCTTGAGCTCATACAAGAGAAGCTCGAGGCCGAGAAA
GCCAGCGAGGCACTTCGTCGCCGACGCGAACAAGACCAGAATCGCGAACGAGAGCTGGACGATGTGAGACGCCGC
GAGCGACCAGACCGTGGACGTGGAGGAAGAGGTGGCGATCGTGGAGATCGCGGTGGCCGTGGAGGTCGAGGACGC
GACTTCAACAGACGATTCTCGCCTCCCAGAGACCGAAACCGCAGCCGCGACCGATTCCGTGAGCCTCCATTGCGA
CGCGACTTGGACTCCTACGTGCCACCTGGTAATCGGCGCCGCCGATCCTCTCGCTCTCCCCACGGCACCCGTTCT
CCATCTGGAACCCCAAAGCCGTCGTCCCCATCTCGCCGAAACCGCGACGAACCACACCACAGACGACGCGAACGC
CCAAGCATCTCAGTCTCTCCCGAGCGACGCCGCGGAGGAGCGAGAAGGCGCAGCAGTCCGGATTACGGTGACCGT
GTTAAAGCAAGACCCATTTCCCGCAGCCGTTCCCCGCGCTCACGTTCCCCCAGAGGAAACCGCCGCCGAAGCTCC
GTCTCTCGCAGCCGCAGTGTATCTCGCTCGCGATCCCGCCGCCCGTCTGGACGTTATGCCCGCCACGATTCCCGT
CGCTTAAGTCGCAGCCGCAGCCGCAGCCGCAGCCGCACCCCTGACCGTACCGGTACACGTGATCGTGGTGAGAAC
CGTCGACGCCGCAGCCCCAGCGGTGATCGGCGCCTTAGCCGCAGCCGCAGCAACAGCCCCAAGAAGGATACTGAC
GGCAAGCGGCCGCTCTCTGTGGAAAGAGACAACCCTGATGACAAACGACGCAAGATGGCTGATGAGAATGAGGTC
TCCTCTACCCGAACCCCTCCGAAAGCTGATGAGCCGCCCAAAACTGATGACAATTCATTCCTATTTAATACTAAG
AAACCGCTTTCTGTTTGGACACAGTCGACTGCATTCCGTGAGAAATTACTCCGGGAGAGATGTATTGCTATGCGT
CGTCAGGCTGCCCAGAAGCCGAGCAGTGCCTCACAGCCAAAGCAGGACTAA
Transcript >Pro_DTO377G3_2|g1434.t1
ATGGCGTCCAGCGTAGATGCCAAGCTGATGAGGCGGACTAAGTTCCCCCCTGAGTTCAGCAAGAAGGTAGATATG
ACCAAGGTCAATATCGAAGTTATGAAGAAATGGATTGCAAGTCAAATCTCCAAGATATTGGGGAACGAGGATGAC
GTCGTTATCGAGCTCTGCTTCGCGCATCTTGAGGGGGCACGCTACCCCGATATTAAATCTCTCCAAATCCAACTC
ACCGGATTTCTAGACAAAGATACCGCCAAGTTCTGTCAGGAGCTGTGGTCGCTGTGCCTAAGCGGTCAGGCCAAT
CCACAGGGCGTCCCGAAGGAACTCCTGGAAGCCAAAAAGCTTGAGCTCATACAAGAGAAGCTCGAGGCCGAGAAA
GCCAGCGAGGCACTTCGTCGCCGACGCGAACAAGACCAGAATCGCGAACGAGAGCTGGACGATGTGAGACGCCGC
GAGCGACCAGACCGTGGACGTGGAGGAAGAGGTGGCGATCGTGGAGATCGCGGTGGCCGTGGAGGTCGAGGACGC
GACTTCAACAGACGATTCTCGCCTCCCAGAGACCGAAACCGCAGCCGCGACCGATTCCGTGAGCCTCCATTGCGA
CGCGACTTGGACTCCTACGTGCCACCTGGTAATCGGCGCCGCCGATCCTCTCGCTCTCCCCACGGCACCCGTTCT
CCATCTGGAACCCCAAAGCCGTCGTCCCCATCTCGCCGAAACCGCGACGAACCACACCACAGACGACGCGAACGC
CCAAGCATCTCAGTCTCTCCCGAGCGACGCCGCGGAGGAGCGAGAAGGCGCAGCAGTCCGGATTACGGTGACCGT
GTTAAAGCAAGACCCATTTCCCGCAGCCGTTCCCCGCGCTCACGTTCCCCCAGAGGAAACCGCCGCCGAAGCTCC
GTCTCTCGCAGCCGCAGTGTATCTCGCTCGCGATCCCGCCGCCCGTCTGGACGTTATGCCCGCCACGATTCCCGT
CGCTTAAGTCGCAGCCGCAGCCGCAGCCGCAGCCGCACCCCTGACCGTACCGGTACACGTGATCGTGGTGAGAAC
CGTCGACGCCGCAGCCCCAGCGGTGATCGGCGCCTTAGCCGCAGCCGCAGCAACAGCCCCAAGAAGGATACTGAC
GGCAAGCGGCCGCTCTCTGTGGAAAGAGACAACCCTGATGACAAACGACGCAAGATGGCTGATGAGAATGAGGTC
TCCTCTACCCGAACCCCTCCGAAAGCTGATGAGCCGCCCAAAACTGATGACAATTCATTCCTATTTAATACTAAG
AAACCGCTTTCTGTTTGGACACAGTCGACTGCATTCCGTGAGAAATTACTCCGGGAGAGATGTATTGCTATGCGT
CGTCAGGCTGCCCAGAAGCCGAGCAGTGCCTCACAGCCAAAGCAGGACTAA
Gene >Pro_DTO377G3_2|g1434.t1
ATGGCGTCCAGCGTAGATGCCAAGCTGATGAGGCGGACTAAGTTCCCCCCTGAGTTCAGCAAGAAGGTAGATATG
ACCAAGGTCAATATCGAAGTTATGAAGAAGTGACTTTCCCCGGGCTTTTTTCGGTATCTCCGGTTTACTGACATT
GCTTTTTCTCCGCCCACAGATGGATTGCAAGTCAAATCTCCAAGATATTGGGGAACGAGGATGACGTCGTTATCG
AGCTCTGCTTCGCGCATCTTGAGGGGGCACGCTACGTAAGTGGTGCCGTCGGATATTTAGTGTCCCAACCCTAGT
TTGCTGACATGTGCTTCTGTTCTAGCCCGATATTAAATCTCTCCAAATCCAACTCACCGGATTTCTAGACAAAGA
TACCGCCAAGTTCTGTCAGGAGCTGTGGTCGCTGTGCCTAAGCGGTCAGGCCAATCCACAGGGCGTCCCGAAGGA
ACTCCTGGAAGCCAAAAAGCTTGAGCTCATACAAGAGAAGGTGATTGTAAGCGTGCTCTCGACCTTGGATATTTT
CTAATTATATTACATTACAGCTCGAGGCCGAGAAAGCCAGCGAGGCACTTCGTCGCCGACGCGAACAAGACCAGA
ATCGCGAACGAGAGCTGGACGATGTGAGACGCCGCGAGCGACCAGACCGTGGACGTGGAGGAAGAGGTGGCGATC
GTGGAGATCGCGGTGGCCGTGGAGGTCGAGGACGCGACTTCAACAGACGATTCTCGCCTCCCAGAGACCGAAACC
GCAGCCGCGACCGATTCCGTGAGCCTCCATTGCGACGCGACTTGGACTCCTACGTGCCACCTGGTAATCGGCGCC
GCCGATCCTCTCGCTCTCCCCACGGCACCCGTTCTCCATCTGGAACCCCAAAGCCGTCGTCCCCATCTCGCCGAA
ACCGCGACGAACCACACCACAGACGACGCGAACGCCCAAGCATCTCAGTCTCTCCCGAGCGACGCCGCGGAGGAG
CGAGAAGGCGCAGCAGTCCGGATTACGGTGACCGTGTTAAAGCAAGACCCATTTCCCGCAGCCGTTCCCCGCGCT
CACGTTCCCCCAGAGGAAACCGCCGCCGAAGCTCCGTCTCTCGCAGCCGCAGTGTATCTCGCTCGCGATCCCGCC
GCCCGTCTGGACGTTATGCCCGCCACGATTCCCGTCGCTTAAGTCGCAGCCGCAGCCGCAGCCGCAGCCGCACCC
CTGACCGTACCGGTACACGTGATCGTGGTGAGAACCGTCGACGCCGCAGCCCCAGCGGTGATCGGCGCCTTAGCC
GCAGCCGCAGCAACAGCCCCAAGAAGGATACTGACGGCAAGCGGCCGCTCTCTGTGGAAAGAGACAACCCTGATG
ACAAACGACGCAAGATGGCTGATGAGAATGAGGTCTCCTCTACCCGAACCCCTCCGAAAGCTGATGAGCCGCCCA
AAACTGATGACAGTGAGACAAAAGTTGCTGAGCAGGTTGGTCATTGAGAATAGAGATTCCTGGTCAACCTCCACC
TTGTATCCTTTACTACCCAGATTCATTCCTATTTAATGTTCGTCTAAACAATTCACATGTCATTTGTTTCTCAAA
TTGCTGTGTTGAATGATATACTAATGAACCTTCAACGCTCAGACTAAGAAACCGCTTTCTGTTTGGACACAGTCG
ACTGCATTCCGTGAGAAATTACTCCGGGAGAGATGTATTGCTATGCGTCGTCAGGCTGCCCAGAAGCCGAGCAGT
GCCTCACAGCCAAAGCAGGACTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail