Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g1423.t1
Gene name
Locationscaffold_01:3757997..3759320
Strand-
Gene length (bp)1323
Transcript length (bp)1323
Coding sequence length (bp)1323
Protein length (aa) 441

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12796 Ank_2 Ankyrin repeats (3 copies) 1.3E-07 64 166
PF12796 Ank_2 Ankyrin repeats (3 copies) 3.8E-12 243 337
PF12796 Ank_2 Ankyrin repeats (3 copies) 3.1E-11 341 410
PF13637 Ank_4 Ankyrin repeats (many copies) 2.2E-08 312 364
PF13637 Ank_4 Ankyrin repeats (many copies) 2.3E-06 351 399
PF13606 Ank_3 Ankyrin repeat 4.5E-03 100 128
PF13606 Ank_3 Ankyrin repeat 6.9E-04 379 406
PF00023 Ank Ankyrin repeat 1.4E-03 100 131
PF00023 Ank Ankyrin repeat 2.4E-02 311 341
PF00023 Ank Ankyrin repeat 1.4E-04 343 377
PF13857 Ank_5 Ankyrin repeats (many copies) 3.8E-07 330 383
PF13857 Ank_5 Ankyrin repeats (many copies) 1.7E-07 370 420

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g1423.t1
MSAPRTSKEGPFSTIPKELYLAISEFLPSLSDLNAFARTTTATYSLLNTDLYKRDAKSPNPKSLFWAATTDNTST
ALKALSAGFDIESKTEINTGQQLKGCTPILLAAYYNSPAVLKLLLLNDKANPNTPDDKWLCSPLSWAVKECCIAI
VQTLLSDSRTDVNQQDKIGDTALMIAVNYQPAMVPLLLCSGRADPRVGNLQGWTPLSRAAQEIDGDVGMLLADHL
RLIIQGDDGEEECQHVFFYAAVMGYVDIVHYMVKCYGEKVDPNAEERQYGRGAFAIAASAERLEVVQFLLEWKAT
NPNVQTDWTKQTPLFVAAQHGHDEIVALLLDSGRVDLEIADKHGTTPLGIAAERNHEDIVRRLLAGPRRANPNAR
DKKGRTPLFHAALSGRLGVVIILLEADGIDLQLSDAEGKTPVAVALEYGNRQVAEVLQRYIDSEP*
Coding >Pro_DTO377G3_2|g1423.t1
ATGAGTGCACCACGCACAAGCAAAGAGGGACCCTTCTCAACCATCCCCAAAGAACTATACCTCGCGATATCTGAG
TTCCTTCCATCACTATCAGACCTAAATGCGTTCGCGCGCACCACCACAGCAACCTACAGTCTCCTCAACACAGAC
CTGTACAAGCGCGATGCAAAGTCTCCCAACCCCAAATCCCTCTTCTGGGCCGCAACAACCGACAACACCTCAACA
GCCCTCAAAGCTCTTTCCGCAGGCTTCGACATCGAATCCAAGACAGAGATAAATACAGGCCAGCAACTCAAGGGC
TGCACCCCAATCCTGCTAGCCGCTTATTACAACAGCCCCGCAGTACTCAAACTGCTCCTGCTAAACGACAAAGCA
AACCCGAACACCCCCGATGACAAATGGCTTTGCTCGCCACTGTCCTGGGCCGTCAAAGAGTGCTGCATAGCCATT
GTTCAGACCCTGCTCAGCGACAGCCGTACAGACGTCAACCAGCAAGACAAGATTGGCGATACCGCACTCATGATT
GCCGTCAACTACCAGCCCGCGATGGTCCCCCTGCTTCTCTGTAGCGGACGGGCTGATCCGCGCGTGGGAAATCTG
CAGGGATGGACGCCTCTCAGTCGTGCCGCGCAGGAGATTGATGGAGACGTGGGCATGTTGCTTGCCGACCACCTG
CGCCTGATTATCCAGGGGGACGATGGCGAAGAGGAGTGTCAGCATGTGTTTTTCTATGCGGCTGTCATGGGCTAT
GTTGACATCGTGCATTACATGGTGAAATGCTATGGAGAGAAGGTCGACCCTAACGCCGAGGAACGACAGTATGGC
CGGGGAGCGTTCGCGATTGCGGCCTCGGCGGAGCGGTTGGAGGTTGTGCAGTTTTTGCTGGAGTGGAAGGCTACG
AACCCTAACGTGCAGACGGATTGGACGAAGCAGACGCCCTTGTTTGTTGCTGCGCAGCATGGACACGACGAGATC
GTGGCGCTGTTGCTTGATTCTGGCAGGGTTGACCTGGAGATTGCTGACAAGCATGGGACTACGCCGTTGGGAATC
GCGGCCGAAAGAAACCACGAGGACATCGTGCGGCGGTTGTTGGCTGGGCCTCGACGGGCTAATCCTAATGCTCGC
GACAAGAAGGGTCGGACACCGCTGTTCCATGCTGCATTGAGCGGTCGCCTGGGTGTTGTGATAATACTCCTTGAG
GCGGATGGAATTGATTTGCAGTTGAGTGATGCAGAGGGGAAGACGCCGGTGGCCGTGGCCTTGGAATATGGCAAT
CGCCAGGTTGCGGAGGTGCTACAGAGATACATTGACAGCGAACCGTGA
Transcript >Pro_DTO377G3_2|g1423.t1
ATGAGTGCACCACGCACAAGCAAAGAGGGACCCTTCTCAACCATCCCCAAAGAACTATACCTCGCGATATCTGAG
TTCCTTCCATCACTATCAGACCTAAATGCGTTCGCGCGCACCACCACAGCAACCTACAGTCTCCTCAACACAGAC
CTGTACAAGCGCGATGCAAAGTCTCCCAACCCCAAATCCCTCTTCTGGGCCGCAACAACCGACAACACCTCAACA
GCCCTCAAAGCTCTTTCCGCAGGCTTCGACATCGAATCCAAGACAGAGATAAATACAGGCCAGCAACTCAAGGGC
TGCACCCCAATCCTGCTAGCCGCTTATTACAACAGCCCCGCAGTACTCAAACTGCTCCTGCTAAACGACAAAGCA
AACCCGAACACCCCCGATGACAAATGGCTTTGCTCGCCACTGTCCTGGGCCGTCAAAGAGTGCTGCATAGCCATT
GTTCAGACCCTGCTCAGCGACAGCCGTACAGACGTCAACCAGCAAGACAAGATTGGCGATACCGCACTCATGATT
GCCGTCAACTACCAGCCCGCGATGGTCCCCCTGCTTCTCTGTAGCGGACGGGCTGATCCGCGCGTGGGAAATCTG
CAGGGATGGACGCCTCTCAGTCGTGCCGCGCAGGAGATTGATGGAGACGTGGGCATGTTGCTTGCCGACCACCTG
CGCCTGATTATCCAGGGGGACGATGGCGAAGAGGAGTGTCAGCATGTGTTTTTCTATGCGGCTGTCATGGGCTAT
GTTGACATCGTGCATTACATGGTGAAATGCTATGGAGAGAAGGTCGACCCTAACGCCGAGGAACGACAGTATGGC
CGGGGAGCGTTCGCGATTGCGGCCTCGGCGGAGCGGTTGGAGGTTGTGCAGTTTTTGCTGGAGTGGAAGGCTACG
AACCCTAACGTGCAGACGGATTGGACGAAGCAGACGCCCTTGTTTGTTGCTGCGCAGCATGGACACGACGAGATC
GTGGCGCTGTTGCTTGATTCTGGCAGGGTTGACCTGGAGATTGCTGACAAGCATGGGACTACGCCGTTGGGAATC
GCGGCCGAAAGAAACCACGAGGACATCGTGCGGCGGTTGTTGGCTGGGCCTCGACGGGCTAATCCTAATGCTCGC
GACAAGAAGGGTCGGACACCGCTGTTCCATGCTGCATTGAGCGGTCGCCTGGGTGTTGTGATAATACTCCTTGAG
GCGGATGGAATTGATTTGCAGTTGAGTGATGCAGAGGGGAAGACGCCGGTGGCCGTGGCCTTGGAATATGGCAAT
CGCCAGGTTGCGGAGGTGCTACAGAGATACATTGACAGCGAACCGTGA
Gene >Pro_DTO377G3_2|g1423.t1
ATGAGTGCACCACGCACAAGCAAAGAGGGACCCTTCTCAACCATCCCCAAAGAACTATACCTCGCGATATCTGAG
TTCCTTCCATCACTATCAGACCTAAATGCGTTCGCGCGCACCACCACAGCAACCTACAGTCTCCTCAACACAGAC
CTGTACAAGCGCGATGCAAAGTCTCCCAACCCCAAATCCCTCTTCTGGGCCGCAACAACCGACAACACCTCAACA
GCCCTCAAAGCTCTTTCCGCAGGCTTCGACATCGAATCCAAGACAGAGATAAATACAGGCCAGCAACTCAAGGGC
TGCACCCCAATCCTGCTAGCCGCTTATTACAACAGCCCCGCAGTACTCAAACTGCTCCTGCTAAACGACAAAGCA
AACCCGAACACCCCCGATGACAAATGGCTTTGCTCGCCACTGTCCTGGGCCGTCAAAGAGTGCTGCATAGCCATT
GTTCAGACCCTGCTCAGCGACAGCCGTACAGACGTCAACCAGCAAGACAAGATTGGCGATACCGCACTCATGATT
GCCGTCAACTACCAGCCCGCGATGGTCCCCCTGCTTCTCTGTAGCGGACGGGCTGATCCGCGCGTGGGAAATCTG
CAGGGATGGACGCCTCTCAGTCGTGCCGCGCAGGAGATTGATGGAGACGTGGGCATGTTGCTTGCCGACCACCTG
CGCCTGATTATCCAGGGGGACGATGGCGAAGAGGAGTGTCAGCATGTGTTTTTCTATGCGGCTGTCATGGGCTAT
GTTGACATCGTGCATTACATGGTGAAATGCTATGGAGAGAAGGTCGACCCTAACGCCGAGGAACGACAGTATGGC
CGGGGAGCGTTCGCGATTGCGGCCTCGGCGGAGCGGTTGGAGGTTGTGCAGTTTTTGCTGGAGTGGAAGGCTACG
AACCCTAACGTGCAGACGGATTGGACGAAGCAGACGCCCTTGTTTGTTGCTGCGCAGCATGGACACGACGAGATC
GTGGCGCTGTTGCTTGATTCTGGCAGGGTTGACCTGGAGATTGCTGACAAGCATGGGACTACGCCGTTGGGAATC
GCGGCCGAAAGAAACCACGAGGACATCGTGCGGCGGTTGTTGGCTGGGCCTCGACGGGCTAATCCTAATGCTCGC
GACAAGAAGGGTCGGACACCGCTGTTCCATGCTGCATTGAGCGGTCGCCTGGGTGTTGTGATAATACTCCTTGAG
GCGGATGGAATTGATTTGCAGTTGAGTGATGCAGAGGGGAAGACGCCGGTGGCCGTGGCCTTGGAATATGGCAAT
CGCCAGGTTGCGGAGGTGCTACAGAGATACATTGACAGCGAACCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail