Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g1413.t1
Gene name
Locationscaffold_01:3730505..3731868
Strand+
Gene length (bp)1363
Transcript length (bp)1140
Coding sequence length (bp)1140
Protein length (aa) 380

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02668 TauD Taurine catabolism dioxygenase TauD, TfdA family 1.3E-58 96 366

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 8.91 3.19 14.63
5d_25C Five days - 25 degrees Celsius 9.61 3.41 15.81
7d_25C Seven days - 25 degrees Celsius 13.78 5.75 21.80
10d_25C Ten days - 25 degrees Celsius 15.24 6.56 23.92
7d_15C Seven days - 15 degrees Celsius 18.68 8.57 28.80
7d_30C Seven days - 30 degrees Celsius 18.94 8.74 29.15

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.890143 no
3d_25C 7d_25C 0.221434 no
3d_25C 7d_15C 0.019353 yes
3d_25C 7d_30C 0.017485 yes
3d_25C 10d_25C 0.106747 no
5d_25C 7d_25C 0.341854 no
5d_25C 7d_15C 0.037779 yes
5d_25C 7d_30C 0.033043 yes
5d_25C 10d_25C 0.186100 no
7d_25C 7d_15C 0.386981 no
7d_25C 7d_30C 0.360917 no
7d_25C 10d_25C 0.821421 no
7d_15C 7d_30C 0.977228 no
7d_15C 10d_25C 0.576836 no
7d_30C 10d_25C 0.550505 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g1413.t1
MAPSLTETVGLRAPPVALPLKADGGFNKENLIGYKIEKDVEIKGTDKVAPVSYPEYLPVWDNETERYPPLTPFEH
YDHGKDADPSFSELLPEGVQVDQLTPFIGSEIHGVQLSQLSDKGKDQLALYVAQRRVVAFRDQDFASLPIQKAVD
YAGYFGRHHIHQTSGAPKGFPEIHLVFRGADDRTGETFLKQRTNTITWHSDVTFEKQPPGTTFLYALDGPTTGGD
TLFADMVQAYKRLSPGFRERLHGLKAVHSGLEQIHASLNGGGIARRDPVSSEHPIVRTHPVTGEKALYVNPQFTR
YIVGYKKEESDNLLKFLYDHIALSQDLQARIRWKAGTVVVWDNRVACHSAVFDWEDGQRRHIARLTPQAEAPYET
PFEG*
Coding >Pro_DTO377G3_2|g1413.t1
ATGGCTCCCTCCCTCACTGAGACAGTAGGCCTTCGCGCCCCGCCTGTTGCGCTTCCGCTCAAGGCGGACGGTGGT
TTCAACAAGGAGAACTTGATCGGCTACAAGATTGAAAAGGATGTTGAGATTAAGGGCACAGACAAGGTGGCTCCT
GTATCTTATCCGGAATATCTGCCTGTTTGGGACAACGAGACAGAAAGATATCCTCCTCTGACGCCCTTTGAGCAC
TACGACCACGGCAAAGACGCCGACCCCTCTTTCTCAGAACTGCTTCCCGAGGGAGTCCAAGTCGACCAGCTCACT
CCCTTCATTGGCTCTGAGATCCACGGCGTGCAACTAAGCCAACTCTCCGACAAGGGCAAGGATCAATTGGCTCTG
TATGTTGCACAGCGACGAGTCGTCGCCTTCCGCGACCAAGACTTCGCATCCCTACCGATTCAAAAGGCCGTCGAC
TATGCCGGCTACTTTGGCCGACACCACATCCACCAGACCTCCGGTGCCCCCAAGGGATTCCCAGAGATCCACCTC
GTCTTCCGCGGTGCCGACGACCGCACTGGCGAGACCTTCCTGAAGCAGCGCACCAACACTATCACATGGCACTCG
GACGTCACCTTCGAGAAGCAGCCCCCCGGCACAACATTCCTGTATGCGCTCGACGGCCCCACCACCGGCGGCGAC
ACCCTCTTCGCCGACATGGTCCAGGCATACAAGCGTCTGTCGCCTGGCTTCCGGGAACGTCTCCACGGATTGAAG
GCCGTGCACTCCGGCCTCGAGCAGATCCACGCTAGTTTGAACGGTGGTGGTATTGCCCGCCGTGATCCTGTTTCA
TCGGAGCACCCCATTGTTCGCACTCACCCCGTTACTGGCGAGAAGGCGCTTTACGTGAACCCCCAGTTCACTCGT
TACATTGTTGGATACAAGAAGGAGGAATCCGATAACCTTCTCAAGTTCCTGTACGACCACATTGCCTTGTCGCAG
GATCTTCAGGCTCGTATTCGCTGGAAGGCTGGTACTGTTGTCGTTTGGGATAACCGTGTGGCTTGCCACTCTGCC
GTTTTCGACTGGGAGGATGGCCAGCGCCGACACATTGCTCGTCTCACACCCCAGGCCGAGGCTCCCTATGAGACA
CCCTTTGAAGGTTAG
Transcript >Pro_DTO377G3_2|g1413.t1
ATGGCTCCCTCCCTCACTGAGACAGTAGGCCTTCGCGCCCCGCCTGTTGCGCTTCCGCTCAAGGCGGACGGTGGT
TTCAACAAGGAGAACTTGATCGGCTACAAGATTGAAAAGGATGTTGAGATTAAGGGCACAGACAAGGTGGCTCCT
GTATCTTATCCGGAATATCTGCCTGTTTGGGACAACGAGACAGAAAGATATCCTCCTCTGACGCCCTTTGAGCAC
TACGACCACGGCAAAGACGCCGACCCCTCTTTCTCAGAACTGCTTCCCGAGGGAGTCCAAGTCGACCAGCTCACT
CCCTTCATTGGCTCTGAGATCCACGGCGTGCAACTAAGCCAACTCTCCGACAAGGGCAAGGATCAATTGGCTCTG
TATGTTGCACAGCGACGAGTCGTCGCCTTCCGCGACCAAGACTTCGCATCCCTACCGATTCAAAAGGCCGTCGAC
TATGCCGGCTACTTTGGCCGACACCACATCCACCAGACCTCCGGTGCCCCCAAGGGATTCCCAGAGATCCACCTC
GTCTTCCGCGGTGCCGACGACCGCACTGGCGAGACCTTCCTGAAGCAGCGCACCAACACTATCACATGGCACTCG
GACGTCACCTTCGAGAAGCAGCCCCCCGGCACAACATTCCTGTATGCGCTCGACGGCCCCACCACCGGCGGCGAC
ACCCTCTTCGCCGACATGGTCCAGGCATACAAGCGTCTGTCGCCTGGCTTCCGGGAACGTCTCCACGGATTGAAG
GCCGTGCACTCCGGCCTCGAGCAGATCCACGCTAGTTTGAACGGTGGTGGTATTGCCCGCCGTGATCCTGTTTCA
TCGGAGCACCCCATTGTTCGCACTCACCCCGTTACTGGCGAGAAGGCGCTTTACGTGAACCCCCAGTTCACTCGT
TACATTGTTGGATACAAGAAGGAGGAATCCGATAACCTTCTCAAGTTCCTGTACGACCACATTGCCTTGTCGCAG
GATCTTCAGGCTCGTATTCGCTGGAAGGCTGGTACTGTTGTCGTTTGGGATAACCGTGTGGCTTGCCACTCTGCC
GTTTTCGACTGGGAGGATGGCCAGCGCCGACACATTGCTCGTCTCACACCCCAGGCCGAGGCTCCCTATGAGACA
CCCTTTGAAGGTTAG
Gene >Pro_DTO377G3_2|g1413.t1
ATGGCTCCCTCCCTCACTGAGACAGTAGGCCTTCGCGCCCCGCCTGTTGCGCTTCCGCTCAAGGCGGACGGTGGT
TTCAACAAGGAGAACTTGATCGGCTACAAGATTGAAAAGGATGTTGAGATTAAGGGCACAGACAAGGTGGCTCCT
GTATCTTATCCGGAATATCTGCCTGTTTGGGACAACGAGACAGAAAGGTATATTGGCCTTGATGATGGCTTCCTA
GGAATACCATATCTAATAGACATCTAGATATCCTCCTCTGACGCCCTTTGAGCACTACGACCACGGCAAAGACGC
CGACCCCTCTTTCTCAGAACTGCTTCCCGAGGGAGTCCAAGTCGACCAGCTCACTCCCTTCATTGGCTCTGAGAT
CCACGGCGTGCAACTAAGCCAACTCTCCGACAAGGGCAAGGATCAATTGGCTCTGTATGTTGCACAGCGACGAGT
CGTCGGTACGTGACAGCCCTTTTTTCCATCTCCATCTCCAAGCACGGATCTAACAAACCATCCAGCCTTCCGCGA
CCAAGACTTCGCATCCCTACCGATTCAAAAGGCCGTCGACTATGCCGGCTACTTTGGCCGACACCACATCCACCA
GACCTCCGGTGCCCCCAAGGGATTCCCAGAGATCCACCTCGTCTTCCGCGGTGCCGACGACCGCACTGGCGAGAC
CTTCCTGAAGCAGCGCACCAACACTATCACATGGCACTCGGACGTCACCTTCGAGAAGCAGCCCCCCGGCACAAC
ATTCCTGTATGCGCTCGACGGCCCCACCACCGGCGGCGACACCCTCTTCGCCGACATGGTCCAGGCATACAAGCG
TCTGTCGCCTGGCTTCCGGGAACGTCTCCACGGATTGAAGGCCGTGCACTCCGGCCTCGAGCAGATCCACGCTAG
TTTGAACGGTGGTGGTATTGCCCGCCGTGATCCTGTTTCATCGGAGCACCCCATTGTTCGCACTCACCCCGTTAC
TGGCGAGAAGGCGCTTTACGTGAACCCCCAGTGTAAGTCTGTCTCGACACTTTTGAATGATTGGGAAAGCTGACA
TGTCGCATAGTCACTCGTTACATTGTTGGATACAAGAAGGAGGAATCCGATAACCTTCTCAAGTTCCTGTACGAC
CACATTGCCTTGTCGCAGGATCTTCAGGCTCGTATTCGCTGGAAGGCTGGTACTGTTGTCGTTTGGGATGTAAGT
TACAGCCTCAGCCTATTCTTTCAATGAGAACAAAAGCTAACCTTCGCAGAACCGTGTGGCTTGCCACTCTGCCGT
TTTCGACTGGGAGGATGGCCAGCGCCGACACATTGCTCGTCTCACACCCCAGGCCGAGGCTCCCTATGAGACACC
CTTTGAAGGTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail