Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g1390.t1
Gene name
Locationscaffold_01:3664717..3666505
Strand-
Gene length (bp)1788
Transcript length (bp)1467
Coding sequence length (bp)1467
Protein length (aa) 489

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00270 DEAD DEAD/DEAH box helicase 2.4E-33 102 269
PF00271 Helicase_C Helicase conserved C-terminal domain 3.5E-23 314 427

GO

GO Term Description Terminal node
GO:0003676 nucleic acid binding Yes
GO:0005524 ATP binding Yes
GO:0000166 nucleotide binding No
GO:0036094 small molecule binding No
GO:0030554 adenyl nucleotide binding No
GO:0003674 molecular_function No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0032559 adenyl ribonucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0043168 anion binding No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No
GO:0032553 ribonucleotide binding No
GO:1901265 nucleoside phosphate binding No
GO:0032555 purine ribonucleotide binding No
GO:0017076 purine nucleotide binding No
GO:0097367 carbohydrate derivative binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 15 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 70.76 43.06 98.47
5d_25C Five days - 25 degrees Celsius 72.64 44.23 101.04
7d_25C Seven days - 25 degrees Celsius 81.33 49.81 112.85
10d_25C Ten days - 25 degrees Celsius 90.50 55.19 125.81
7d_15C Seven days - 15 degrees Celsius 80.24 48.82 111.65
7d_30C Seven days - 30 degrees Celsius 67.37 40.94 93.79

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.941011 no
3d_25C 7d_25C 0.597830 no
3d_25C 7d_15C 0.653019 no
3d_25C 7d_30C 0.882216 no
3d_25C 10d_25C 0.302361 no
5d_25C 7d_25C 0.683475 no
5d_25C 7d_15C 0.733503 no
5d_25C 7d_30C 0.804291 no
5d_25C 10d_25C 0.362711 no
7d_25C 7d_15C 0.969733 no
7d_25C 7d_30C 0.448193 no
7d_25C 10d_25C 0.708050 no
7d_15C 7d_30C 0.499181 no
7d_15C 10d_25C 0.670757 no
7d_30C 10d_25C 0.201864 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g1390.t1
MSENPETAPAAGSLADRVTKPDESIPTDPANVSTISKEDGASGPAQGSADLEEPDYTVAVKLSDLQADPNNPLFS
VKSFEDLGLDARILKGLSTMNFRKPSKVQERALPLLMSNPPKNLVGQSQSGTGKTAAFVLNILSRLDLSTEQSQI
TPQALILAPTRELARQIVGVIQIMGQFLEGLIIGTAVPADSNARPTKMDCSVVVGTPGTVQDMIKKRVMNPTGLK
VLVLDEADNMLDQQGLGDQCIRAKAMLPRNVQIVLFSATFPAHVYRYAGKFAPAANEITLQHEELTVEGIKQLYM
DCSTDEEKYQNLVQLYGLLTVGSSIIFVRTRASAVEIEKRMVAEGHTVASLTGGVEGSQRDAVIDSFRSGEAKVL
ITTNVLARGIDVSTVSLVVNYDIPEEYSGGQRTNTPDYQTYLHRIGRTGRFGRIGVAISFVSNRNEWEMLRKIQE
HFQCTIDRIDTSDWDEVEEMIKKTIKNTRAQANFAQGN*
Coding >Pro_DTO377G3_2|g1390.t1
ATGTCTGAGAATCCAGAGACTGCCCCTGCTGCAGGCTCCTTGGCTGACCGTGTCACCAAGCCTGACGAGTCGATT
CCCACCGATCCCGCCAATGTCTCCACCATTTCTAAGGAGGATGGCGCCTCTGGCCCCGCGCAGGGCTCGGCAGAT
CTCGAGGAGCCTGACTACACCGTCGCGGTGAAATTGAGTGACTTGCAAGCGGACCCCAACAACCCCCTGTTCTCG
GTCAAAAGCTTTGAAGATCTAGGCCTGGATGCGCGCATTCTGAAAGGTCTCTCTACCATGAACTTCCGCAAGCCG
TCCAAGGTCCAGGAGCGTGCTCTTCCCCTTCTGATGAGCAATCCTCCGAAGAATTTGGTTGGTCAGTCGCAGTCT
GGTACCGGTAAAACCGCAGCCTTTGTCCTCAACATTCTTAGTCGTCTTGACCTCTCAACGGAGCAGTCGCAGATA
ACACCCCAAGCTCTGATTCTCGCTCCTACTCGTGAATTGGCCCGCCAGATTGTCGGAGTGATCCAGATTATGGGT
CAATTCCTTGAAGGGCTCATTATCGGAACTGCTGTTCCTGCCGATTCTAATGCTCGCCCGACGAAGATGGATTGT
TCGGTTGTGGTTGGCACACCTGGTACTGTTCAGGATATGATCAAGAAGCGTGTCATGAACCCTACCGGTTTGAAG
GTGCTTGTCCTGGATGAGGCAGATAACATGCTTGACCAGCAAGGCCTGGGAGACCAGTGCATTCGGGCCAAGGCG
ATGCTTCCCCGAAATGTTCAAATCGTCCTGTTCTCGGCGACCTTCCCCGCTCATGTCTACCGCTATGCGGGCAAG
TTTGCTCCTGCCGCTAACGAGATTACCCTCCAACACGAGGAGTTGACTGTTGAGGGCATTAAACAACTCTACATG
GATTGCAGCACTGACGAGGAAAAGTATCAGAATCTCGTTCAGCTTTACGGACTGCTCACTGTCGGATCCTCAATC
ATTTTCGTTCGGACCCGTGCCTCTGCCGTTGAGATCGAGAAGCGTATGGTTGCTGAGGGCCACACTGTCGCCTCG
CTGACTGGTGGTGTCGAGGGATCCCAGCGTGACGCGGTGATTGATTCCTTCCGCAGCGGTGAAGCTAAGGTTCTC
ATCACAACCAATGTTCTCGCTCGTGGAATCGATGTATCTACAGTTTCCTTGGTCGTCAACTACGATATCCCCGAG
GAATACTCTGGCGGTCAGCGCACCAACACACCCGACTACCAGACCTATCTGCACCGTATCGGTCGTACTGGTCGC
TTTGGTCGCATTGGCGTGGCAATCTCATTTGTTTCCAACCGCAACGAGTGGGAGATGCTTCGCAAGATCCAAGAG
CACTTCCAGTGTACCATCGACCGCATTGATACTAGCGACTGGGATGAAGTGGAGGAGATGATCAAGAAGACCATC
AAGAATACCCGAGCTCAGGCCAACTTCGCCCAAGGCAACTAA
Transcript >Pro_DTO377G3_2|g1390.t1
ATGTCTGAGAATCCAGAGACTGCCCCTGCTGCAGGCTCCTTGGCTGACCGTGTCACCAAGCCTGACGAGTCGATT
CCCACCGATCCCGCCAATGTCTCCACCATTTCTAAGGAGGATGGCGCCTCTGGCCCCGCGCAGGGCTCGGCAGAT
CTCGAGGAGCCTGACTACACCGTCGCGGTGAAATTGAGTGACTTGCAAGCGGACCCCAACAACCCCCTGTTCTCG
GTCAAAAGCTTTGAAGATCTAGGCCTGGATGCGCGCATTCTGAAAGGTCTCTCTACCATGAACTTCCGCAAGCCG
TCCAAGGTCCAGGAGCGTGCTCTTCCCCTTCTGATGAGCAATCCTCCGAAGAATTTGGTTGGTCAGTCGCAGTCT
GGTACCGGTAAAACCGCAGCCTTTGTCCTCAACATTCTTAGTCGTCTTGACCTCTCAACGGAGCAGTCGCAGATA
ACACCCCAAGCTCTGATTCTCGCTCCTACTCGTGAATTGGCCCGCCAGATTGTCGGAGTGATCCAGATTATGGGT
CAATTCCTTGAAGGGCTCATTATCGGAACTGCTGTTCCTGCCGATTCTAATGCTCGCCCGACGAAGATGGATTGT
TCGGTTGTGGTTGGCACACCTGGTACTGTTCAGGATATGATCAAGAAGCGTGTCATGAACCCTACCGGTTTGAAG
GTGCTTGTCCTGGATGAGGCAGATAACATGCTTGACCAGCAAGGCCTGGGAGACCAGTGCATTCGGGCCAAGGCG
ATGCTTCCCCGAAATGTTCAAATCGTCCTGTTCTCGGCGACCTTCCCCGCTCATGTCTACCGCTATGCGGGCAAG
TTTGCTCCTGCCGCTAACGAGATTACCCTCCAACACGAGGAGTTGACTGTTGAGGGCATTAAACAACTCTACATG
GATTGCAGCACTGACGAGGAAAAGTATCAGAATCTCGTTCAGCTTTACGGACTGCTCACTGTCGGATCCTCAATC
ATTTTCGTTCGGACCCGTGCCTCTGCCGTTGAGATCGAGAAGCGTATGGTTGCTGAGGGCCACACTGTCGCCTCG
CTGACTGGTGGTGTCGAGGGATCCCAGCGTGACGCGGTGATTGATTCCTTCCGCAGCGGTGAAGCTAAGGTTCTC
ATCACAACCAATGTTCTCGCTCGTGGAATCGATGTATCTACAGTTTCCTTGGTCGTCAACTACGATATCCCCGAG
GAATACTCTGGCGGTCAGCGCACCAACACACCCGACTACCAGACCTATCTGCACCGTATCGGTCGTACTGGTCGC
TTTGGTCGCATTGGCGTGGCAATCTCATTTGTTTCCAACCGCAACGAGTGGGAGATGCTTCGCAAGATCCAAGAG
CACTTCCAGTGTACCATCGACCGCATTGATACTAGCGACTGGGATGAAGTGGAGGAGATGATCAAGAAGACCATC
AAGAATACCCGAGCTCAGGCCAACTTCGCCCAAGGCAACTAA
Gene >Pro_DTO377G3_2|g1390.t1
ATGTCTGAGAATCCAGAGACTGCCCCTGCTGCAGGCTCCTTGGCTGACCGTGTCACCAAGCCTGACGAGTCGATT
CCCACCGGTACGAGACGAGACCACGCCACCGTCGCTGTTCCTCCAGTCCACACGACCGGAAAACGCGCTACCCCG
GCTGATAGCTAATATCCTCTTTACTTTCACAGATCCCGCCAATGTCTCCACCATTTCTAAGGAGGATGGCGCCTC
TGGCCCCGCGCAGGGCTCGGCAGATCTCGAGGAGCCTGACTACACCGTCGCGGTGAAATTGAGTGACTTGCAAGC
GGACCCCAACAACCCCCTGTTCTCGGTCAAAAGCTTTGAAGATCTAGGCCTGCAAGTGCTACCCACTGATACGCG
TCCAAATGAGAGTCTCACAGCTAACCTGATTGACACTCCAGGGATGCGCGCATTCTGAAAGGTCTCTCTACCATG
AACTTCCGCAAGCCGTCCAAGGTCCAGGAGCGTGCTCTTCCCCTTCTGATGAGCAATCCTCCGAAGAATTTGGTT
GGTCAGTCGCAGTCTGGTACCGGTAAAACCGCAGCCTTTGTCCTCAACATTCTTAGTCGTCTTGACCTCTCAACG
GAGCAGTCGCAGATAACACCCCAAGCTCTGATTCTCGCTCCTACTCGTGAATTGGCCCGCCAGATTGTCGGAGTG
ATCCAGATTATGGGTCAATTCCTTGAAGGGCTCATTATCGGAACTGCTGTTCCTGCCGATTCTAATGCTCGCCCG
ACGAAGATGGATTGTTCGGTTGTGGTTGGCACACCTGGTACTGTTCAGGATATGATCAAGAAGCGTGTCATGAAC
CCTACCGGTTTGAAGGTGCTTGTCCTGGATGAGGCAGATAACATGCTTGACCAGCAAGGCCTGGGAGACCAGTGC
ATTCGGGCCAAGGCGTAAGTACTAATTCCACCACTCAAAGTACCGGGCTAATAGTTCACCTGAATAGGATGCTTC
CCCGAAATGTTCAAATCGTCCTGTTCTCGGCGACCTTCCCCGCTCATGTCTACCGCTATGCGGGCAAGTTTGCTC
CTGCCGCTAACGAGATTACCCTCCAACACGAGGAGTTGACTGTTGAGGGCATTAAACAACTCTACATGGATTGCA
GCACTGACGAGGAAAAGTATCAGAATCTCGTTCAGCTTTACGGACTGCTCACTGTCGGATCCTCAATCATTTTCG
TTCGGGTAAGTATTATCTCAGATTAAGATTGGAATTTTGCTGACCGCTCTCTAGACCCGTGCCTCTGCCGTTGAG
ATCGAGAAGCGTATGGTTGCTGAGGGCCACACTGTCGCCTCGCTGACTGGTGGTGTCGAGGGATCCCAGCGTGAC
GCGGTGATTGATTCCTTCCGCAGCGGTGAAGCTAAGGTTCTCATCACAACCAATGTTCTCGCTCGTGGAATCGAT
GTATCTACAGTTTCCTTGGTCGTCAACTACGTGAGTTCATTGTTAATTCGCTTTCACGTCCAAACTAACCATTCT
CGCATTCAGGATATCCCCGAGGAATACTCTGGCGGTCAGCGCACCAACACACCCGACTACCAGACCTATCTGCAC
CGTATCGGTCGTACTGGTCGCTTTGGTCGCATTGGCGTGGCAATCTCATTTGTTTCCAACCGCAACGAGTGGGAG
ATGCTTCGCAAGATCCAAGAGCACTTCCAGTGTACCATCGACCGCATTGATACTAGCGACTGGGATGAAGTGGAG
GAGATGATCAAGAAGACCATCAAGAATACCCGAGCTCAGGCCAACTTCGCCCAAGGCAACTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail