Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g1386.t1
Gene name
Locationscaffold_01:3652009..3655117
Strand-
Gene length (bp)3108
Transcript length (bp)3108
Coding sequence length (bp)3108
Protein length (aa) 1036

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09427 DUF2014 Domain of unknown function (DUF2014) 5.0E-98 507 768
PF00010 HLH Helix-loop-helix DNA-binding domain 4.3E-18 165 237

GO

GO Term Description Terminal node
GO:0032933 SREBP signaling pathway Yes
GO:0045944 positive regulation of transcription by RNA polymerase II Yes
GO:0046983 protein dimerization activity Yes
GO:0009893 positive regulation of metabolic process No
GO:0051252 regulation of RNA metabolic process No
GO:0051173 positive regulation of nitrogen compound metabolic process No
GO:0045893 positive regulation of transcription, DNA-templated No
GO:2000112 regulation of cellular macromolecule biosynthetic process No
GO:0048522 positive regulation of cellular process No
GO:0006950 response to stress No
GO:0033554 cellular response to stress No
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:0080090 regulation of primary metabolic process No
GO:0050794 regulation of cellular process No
GO:1903508 positive regulation of nucleic acid-templated transcription No
GO:0010604 positive regulation of macromolecule metabolic process No
GO:0006991 response to sterol depletion No
GO:0010628 positive regulation of gene expression No
GO:0005515 protein binding No
GO:0010557 positive regulation of macromolecule biosynthetic process No
GO:1903506 regulation of nucleic acid-templated transcription No
GO:0051254 positive regulation of RNA metabolic process No
GO:0007165 signal transduction No
GO:0065007 biological regulation No
GO:0006355 regulation of transcription, DNA-templated No
GO:0050789 regulation of biological process No
GO:0009891 positive regulation of biosynthetic process No
GO:0008150 biological_process No
GO:0010556 regulation of macromolecule biosynthetic process No
GO:0010468 regulation of gene expression No
GO:0050896 response to stimulus No
GO:0019222 regulation of metabolic process No
GO:0005488 binding No
GO:2001141 regulation of RNA biosynthetic process No
GO:0071501 cellular response to sterol depletion No
GO:0006984 ER-nucleus signaling pathway No
GO:0051716 cellular response to stimulus No
GO:0003674 molecular_function No
GO:0045935 positive regulation of nucleobase-containing compound metabolic process No
GO:0031325 positive regulation of cellular metabolic process No
GO:0051171 regulation of nitrogen compound metabolic process No
GO:0060255 regulation of macromolecule metabolic process No
GO:0031323 regulation of cellular metabolic process No
GO:0031328 positive regulation of cellular biosynthetic process No
GO:1902680 positive regulation of RNA biosynthetic process No
GO:0031326 regulation of cellular biosynthetic process No
GO:0006357 regulation of transcription by RNA polymerase II No
GO:0048518 positive regulation of biological process No
GO:0009987 cellular process No
GO:0009889 regulation of biosynthetic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 69 0.45

Transmembrane Domains

Domain # Start End Length
1 427 449 22
2 559 578 19

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Helix-loop-helix

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g1386.t1
MSGPNMENDFQLFSSRNPGGDETRGNGHLFTHPVGENVNQDWTQWMRWDEPMFSEGDQKPMASSIDLPSISPQTD
MSSPSHLNYGDFSPNLPLGLMEIPSEPNAGNNLGYTHRLPGPNRTSQQQPYGLVSPISSVGTSRKRKTGSDDDAT
TVTGPVQPGKKMPAKKRAHNVIEKRYRANLNDKIAELRDSVPSLRSPKNPNGGSADDDDEAEGANAANKLNKASI
LSKATEYIKHLEIRNQRLEDENTDLKNRLRQADKVADQAATSSGSVSSPSNYASTDSNSGTSPSVFSQAEDVSSE
SSPTSPNPPEGLLPVPDAWKRMRAETAKQGVFAESYIKYPSSSSSSHQPQYAREDTSTRRSRMPNKYMLGALAGL
MVLEGMGSDDSESESKGLFSLPISLLGRFQTPTLAHCEFYLKQFWYSWQARAFSHFLILATLVVGSAFIVFVYLF
NAQPITRRGPSKLATEGPAAPLTSSDFRRQAWLTSMQRVGVPRHRFFREWYVVTSRCFEYVLRCFMGWKVYSWAT
GITEEDEKGRVKTWDIAIDAQLTGGDAEISKSRLVLTIFAAGTLPCTPARMIIKALHVRILLWNVGEAGSWSFHV
SNDIARALARFQWGVAREINSALPEGHPDQLPPHLAALIKLDCEDVMIDNIIQRAVNLTWNRPTQEGTGDDEVLL
DVVDEDPAIQCSQDALAAWWSSHLLQTALLNYFEASGKGPVSKASRDAFKEKIRMSLDVAPVLSAAHTRALVMKA
VFFEHNRIENVGAVLAALPKEKRKGSHSHSSNFLDSSLPVSVRDEISIAVRCAMIATIVTERSTGGVSSLPDSFT
MEKAVSWFNQLPIDPVELSLIGFSSVYHLLHLLASDVDYIASSDSSPSAPASEAAISSADDEAEEKPRPNQKLSL
CPRDIPNLGRVSAELIYWARNAYTPAFYGFSSTLVEVIVNSCTAICQNAGINVEDFVHTAPDRAMSKKRRTRRRK
GESQSSESDADQDLIDYPVERPPLRRARSASNDTGYGSLSVEEDGRPIPHAPSNVQEVPS*
Coding >Pro_DTO377G3_2|g1386.t1
ATGTCCGGTCCTAATATGGAGAATGACTTTCAGCTATTTTCTTCACGAAACCCTGGTGGGGATGAGACACGAGGA
AATGGTCATTTGTTCACACATCCCGTCGGAGAGAATGTGAACCAGGATTGGACCCAGTGGATGCGATGGGATGAA
CCAATGTTCTCGGAAGGAGATCAAAAGCCAATGGCCTCATCTATAGATCTACCATCCATCTCCCCGCAGACAGAT
ATGAGCTCCCCAAGTCATTTGAACTACGGGGACTTCTCGCCTAACCTTCCACTCGGCTTGATGGAAATCCCATCC
GAGCCCAATGCCGGGAACAACCTTGGGTACACCCATCGCCTGCCTGGACCAAATCGTACGAGCCAGCAGCAACCT
TACGGTCTGGTGTCTCCAATCTCCAGTGTTGGCACAAGCCGGAAGCGAAAGACGGGCAGCGATGACGATGCCACC
ACAGTGACTGGACCAGTGCAGCCGGGCAAGAAAATGCCCGCCAAGAAGCGAGCTCACAACGTTATTGAGAAGCGG
TATCGCGCCAATTTGAACGATAAAATCGCCGAACTTCGCGACAGTGTTCCCAGCCTGCGGTCGCCCAAGAATCCG
AATGGAGGCTCAGCCGATGATGACGACGAAGCGGAGGGAGCAAATGCTGCCAACAAGCTCAACAAAGCATCCATT
TTGTCGAAAGCGACGGAGTACATCAAACATCTGGAAATTCGTAACCAACGCTTGGAAGACGAAAACACCGACTTG
AAGAACCGACTCCGCCAGGCTGATAAAGTAGCAGATCAGGCCGCCACATCCTCAGGTTCTGTGTCCTCGCCCAGC
AACTACGCCTCGACGGACTCGAACTCCGGTACATCACCTAGTGTCTTTTCTCAGGCGGAAGATGTGTCCAGCGAG
AGTTCACCCACCTCTCCGAACCCCCCAGAAGGCCTCCTTCCAGTTCCCGATGCGTGGAAACGTATGCGAGCTGAA
ACGGCAAAGCAAGGTGTCTTTGCTGAATCATACATCAAGTACCCCTCGTCATCATCCTCATCTCATCAACCGCAG
TATGCGAGAGAAGATACCTCCACTCGACGTTCAAGGATGCCCAACAAATATATGCTGGGTGCTCTTGCCGGTCTG
ATGGTTCTTGAAGGTATGGGCTCTGACGATTCCGAGTCCGAGTCGAAGGGCCTGTTTTCACTCCCCATCAGTCTT
CTCGGCCGTTTCCAAACCCCCACACTGGCACATTGTGAATTCTACCTGAAGCAGTTCTGGTACTCGTGGCAGGCA
CGTGCATTTTCGCATTTCCTCATTCTGGCAACGCTGGTCGTTGGGAGTGCCTTTATCGTTTTTGTCTACTTGTTC
AATGCGCAGCCAATCACCCGACGCGGCCCATCCAAATTGGCTACTGAGGGCCCGGCTGCGCCTCTTACATCTAGT
GATTTCCGTCGGCAGGCTTGGCTGACTAGCATGCAACGGGTCGGTGTTCCACGTCATAGATTCTTCCGAGAGTGG
TATGTTGTTACTTCGAGATGCTTCGAATACGTCTTACGATGCTTCATGGGATGGAAAGTCTACTCATGGGCCACC
GGAATCACCGAGGAGGATGAGAAGGGACGAGTCAAGACTTGGGATATCGCAATTGATGCTCAACTCACTGGTGGA
GATGCTGAGATCAGCAAGAGCCGCCTTGTGCTCACTATCTTCGCTGCCGGCACACTCCCTTGTACTCCCGCAAGA
ATGATAATAAAGGCCTTGCATGTCCGCATTCTCTTGTGGAACGTCGGAGAGGCGGGCTCCTGGTCATTCCATGTG
TCAAACGACATTGCGCGAGCTCTTGCCAGATTCCAGTGGGGTGTGGCTCGAGAAATCAATTCCGCACTGCCCGAG
GGTCACCCTGATCAGCTTCCCCCTCATCTTGCTGCCCTGATCAAACTGGATTGCGAGGATGTCATGATTGACAAC
ATTATCCAGCGTGCTGTGAACCTGACCTGGAATCGACCAACCCAGGAGGGTACTGGCGATGACGAAGTGCTGCTT
GATGTTGTGGATGAGGACCCAGCTATTCAATGTTCCCAAGATGCACTTGCAGCTTGGTGGTCCAGTCATCTTCTC
CAAACCGCTCTTCTCAACTATTTCGAAGCAAGCGGGAAGGGCCCGGTGTCCAAGGCAAGCCGTGATGCATTCAAA
GAGAAGATTCGGATGTCCCTTGATGTGGCGCCGGTGCTTTCCGCCGCGCATACTCGGGCACTCGTGATGAAAGCC
GTTTTCTTCGAGCACAACCGCATTGAAAATGTTGGGGCGGTTCTTGCCGCGCTACCGAAAGAGAAGAGAAAGGGA
AGTCACAGCCATTCATCCAACTTCCTTGATTCCTCTCTGCCCGTTTCCGTGCGGGATGAAATCTCCATCGCCGTG
CGCTGTGCTATGATTGCCACCATTGTCACCGAACGGTCCACAGGTGGTGTCTCCTCACTACCTGACTCCTTCACC
ATGGAGAAGGCCGTGTCTTGGTTCAATCAGCTTCCGATTGATCCAGTCGAGCTTTCTCTCATCGGTTTCTCGTCT
GTCTATCATCTCCTACACCTCCTCGCCTCTGACGTGGATTACATTGCGTCATCCGATTCATCCCCTTCGGCTCCA
GCCTCGGAGGCGGCTATCTCTTCCGCAGACGACGAAGCCGAAGAAAAACCCCGTCCGAATCAAAAGCTCTCCCTC
TGCCCCCGTGACATTCCCAATCTCGGGCGGGTATCAGCAGAGCTCATATATTGGGCCCGAAATGCCTACACCCCG
GCTTTCTACGGCTTTTCATCTACTCTCGTCGAGGTGATTGTCAACTCGTGCACAGCAATCTGCCAAAATGCAGGC
ATCAATGTTGAAGATTTTGTGCACACCGCACCTGACAGGGCTATGTCTAAGAAACGCAGGACCCGTCGTCGCAAG
GGAGAATCTCAGTCATCCGAAAGCGACGCCGATCAAGACCTGATTGACTATCCTGTCGAAAGACCGCCTCTCCGC
CGGGCACGATCAGCTAGCAACGACACTGGGTATGGCAGCCTCTCTGTTGAAGAAGATGGAAGGCCAATACCTCAT
GCCCCTTCCAATGTACAGGAGGTCCCCAGCTGA
Transcript >Pro_DTO377G3_2|g1386.t1
ATGTCCGGTCCTAATATGGAGAATGACTTTCAGCTATTTTCTTCACGAAACCCTGGTGGGGATGAGACACGAGGA
AATGGTCATTTGTTCACACATCCCGTCGGAGAGAATGTGAACCAGGATTGGACCCAGTGGATGCGATGGGATGAA
CCAATGTTCTCGGAAGGAGATCAAAAGCCAATGGCCTCATCTATAGATCTACCATCCATCTCCCCGCAGACAGAT
ATGAGCTCCCCAAGTCATTTGAACTACGGGGACTTCTCGCCTAACCTTCCACTCGGCTTGATGGAAATCCCATCC
GAGCCCAATGCCGGGAACAACCTTGGGTACACCCATCGCCTGCCTGGACCAAATCGTACGAGCCAGCAGCAACCT
TACGGTCTGGTGTCTCCAATCTCCAGTGTTGGCACAAGCCGGAAGCGAAAGACGGGCAGCGATGACGATGCCACC
ACAGTGACTGGACCAGTGCAGCCGGGCAAGAAAATGCCCGCCAAGAAGCGAGCTCACAACGTTATTGAGAAGCGG
TATCGCGCCAATTTGAACGATAAAATCGCCGAACTTCGCGACAGTGTTCCCAGCCTGCGGTCGCCCAAGAATCCG
AATGGAGGCTCAGCCGATGATGACGACGAAGCGGAGGGAGCAAATGCTGCCAACAAGCTCAACAAAGCATCCATT
TTGTCGAAAGCGACGGAGTACATCAAACATCTGGAAATTCGTAACCAACGCTTGGAAGACGAAAACACCGACTTG
AAGAACCGACTCCGCCAGGCTGATAAAGTAGCAGATCAGGCCGCCACATCCTCAGGTTCTGTGTCCTCGCCCAGC
AACTACGCCTCGACGGACTCGAACTCCGGTACATCACCTAGTGTCTTTTCTCAGGCGGAAGATGTGTCCAGCGAG
AGTTCACCCACCTCTCCGAACCCCCCAGAAGGCCTCCTTCCAGTTCCCGATGCGTGGAAACGTATGCGAGCTGAA
ACGGCAAAGCAAGGTGTCTTTGCTGAATCATACATCAAGTACCCCTCGTCATCATCCTCATCTCATCAACCGCAG
TATGCGAGAGAAGATACCTCCACTCGACGTTCAAGGATGCCCAACAAATATATGCTGGGTGCTCTTGCCGGTCTG
ATGGTTCTTGAAGGTATGGGCTCTGACGATTCCGAGTCCGAGTCGAAGGGCCTGTTTTCACTCCCCATCAGTCTT
CTCGGCCGTTTCCAAACCCCCACACTGGCACATTGTGAATTCTACCTGAAGCAGTTCTGGTACTCGTGGCAGGCA
CGTGCATTTTCGCATTTCCTCATTCTGGCAACGCTGGTCGTTGGGAGTGCCTTTATCGTTTTTGTCTACTTGTTC
AATGCGCAGCCAATCACCCGACGCGGCCCATCCAAATTGGCTACTGAGGGCCCGGCTGCGCCTCTTACATCTAGT
GATTTCCGTCGGCAGGCTTGGCTGACTAGCATGCAACGGGTCGGTGTTCCACGTCATAGATTCTTCCGAGAGTGG
TATGTTGTTACTTCGAGATGCTTCGAATACGTCTTACGATGCTTCATGGGATGGAAAGTCTACTCATGGGCCACC
GGAATCACCGAGGAGGATGAGAAGGGACGAGTCAAGACTTGGGATATCGCAATTGATGCTCAACTCACTGGTGGA
GATGCTGAGATCAGCAAGAGCCGCCTTGTGCTCACTATCTTCGCTGCCGGCACACTCCCTTGTACTCCCGCAAGA
ATGATAATAAAGGCCTTGCATGTCCGCATTCTCTTGTGGAACGTCGGAGAGGCGGGCTCCTGGTCATTCCATGTG
TCAAACGACATTGCGCGAGCTCTTGCCAGATTCCAGTGGGGTGTGGCTCGAGAAATCAATTCCGCACTGCCCGAG
GGTCACCCTGATCAGCTTCCCCCTCATCTTGCTGCCCTGATCAAACTGGATTGCGAGGATGTCATGATTGACAAC
ATTATCCAGCGTGCTGTGAACCTGACCTGGAATCGACCAACCCAGGAGGGTACTGGCGATGACGAAGTGCTGCTT
GATGTTGTGGATGAGGACCCAGCTATTCAATGTTCCCAAGATGCACTTGCAGCTTGGTGGTCCAGTCATCTTCTC
CAAACCGCTCTTCTCAACTATTTCGAAGCAAGCGGGAAGGGCCCGGTGTCCAAGGCAAGCCGTGATGCATTCAAA
GAGAAGATTCGGATGTCCCTTGATGTGGCGCCGGTGCTTTCCGCCGCGCATACTCGGGCACTCGTGATGAAAGCC
GTTTTCTTCGAGCACAACCGCATTGAAAATGTTGGGGCGGTTCTTGCCGCGCTACCGAAAGAGAAGAGAAAGGGA
AGTCACAGCCATTCATCCAACTTCCTTGATTCCTCTCTGCCCGTTTCCGTGCGGGATGAAATCTCCATCGCCGTG
CGCTGTGCTATGATTGCCACCATTGTCACCGAACGGTCCACAGGTGGTGTCTCCTCACTACCTGACTCCTTCACC
ATGGAGAAGGCCGTGTCTTGGTTCAATCAGCTTCCGATTGATCCAGTCGAGCTTTCTCTCATCGGTTTCTCGTCT
GTCTATCATCTCCTACACCTCCTCGCCTCTGACGTGGATTACATTGCGTCATCCGATTCATCCCCTTCGGCTCCA
GCCTCGGAGGCGGCTATCTCTTCCGCAGACGACGAAGCCGAAGAAAAACCCCGTCCGAATCAAAAGCTCTCCCTC
TGCCCCCGTGACATTCCCAATCTCGGGCGGGTATCAGCAGAGCTCATATATTGGGCCCGAAATGCCTACACCCCG
GCTTTCTACGGCTTTTCATCTACTCTCGTCGAGGTGATTGTCAACTCGTGCACAGCAATCTGCCAAAATGCAGGC
ATCAATGTTGAAGATTTTGTGCACACCGCACCTGACAGGGCTATGTCTAAGAAACGCAGGACCCGTCGTCGCAAG
GGAGAATCTCAGTCATCCGAAAGCGACGCCGATCAAGACCTGATTGACTATCCTGTCGAAAGACCGCCTCTCCGC
CGGGCACGATCAGCTAGCAACGACACTGGGTATGGCAGCCTCTCTGTTGAAGAAGATGGAAGGCCAATACCTCAT
GCCCCTTCCAATGTACAGGAGGTCCCCAGCTGA
Gene >Pro_DTO377G3_2|g1386.t1
ATGTCCGGTCCTAATATGGAGAATGACTTTCAGCTATTTTCTTCACGAAACCCTGGTGGGGATGAGACACGAGGA
AATGGTCATTTGTTCACACATCCCGTCGGAGAGAATGTGAACCAGGATTGGACCCAGTGGATGCGATGGGATGAA
CCAATGTTCTCGGAAGGAGATCAAAAGCCAATGGCCTCATCTATAGATCTACCATCCATCTCCCCGCAGACAGAT
ATGAGCTCCCCAAGTCATTTGAACTACGGGGACTTCTCGCCTAACCTTCCACTCGGCTTGATGGAAATCCCATCC
GAGCCCAATGCCGGGAACAACCTTGGGTACACCCATCGCCTGCCTGGACCAAATCGTACGAGCCAGCAGCAACCT
TACGGTCTGGTGTCTCCAATCTCCAGTGTTGGCACAAGCCGGAAGCGAAAGACGGGCAGCGATGACGATGCCACC
ACAGTGACTGGACCAGTGCAGCCGGGCAAGAAAATGCCCGCCAAGAAGCGAGCTCACAACGTTATTGAGAAGCGG
TATCGCGCCAATTTGAACGATAAAATCGCCGAACTTCGCGACAGTGTTCCCAGCCTGCGGTCGCCCAAGAATCCG
AATGGAGGCTCAGCCGATGATGACGACGAAGCGGAGGGAGCAAATGCTGCCAACAAGCTCAACAAAGCATCCATT
TTGTCGAAAGCGACGGAGTACATCAAACATCTGGAAATTCGTAACCAACGCTTGGAAGACGAAAACACCGACTTG
AAGAACCGACTCCGCCAGGCTGATAAAGTAGCAGATCAGGCCGCCACATCCTCAGGTTCTGTGTCCTCGCCCAGC
AACTACGCCTCGACGGACTCGAACTCCGGTACATCACCTAGTGTCTTTTCTCAGGCGGAAGATGTGTCCAGCGAG
AGTTCACCCACCTCTCCGAACCCCCCAGAAGGCCTCCTTCCAGTTCCCGATGCGTGGAAACGTATGCGAGCTGAA
ACGGCAAAGCAAGGTGTCTTTGCTGAATCATACATCAAGTACCCCTCGTCATCATCCTCATCTCATCAACCGCAG
TATGCGAGAGAAGATACCTCCACTCGACGTTCAAGGATGCCCAACAAATATATGCTGGGTGCTCTTGCCGGTCTG
ATGGTTCTTGAAGGTATGGGCTCTGACGATTCCGAGTCCGAGTCGAAGGGCCTGTTTTCACTCCCCATCAGTCTT
CTCGGCCGTTTCCAAACCCCCACACTGGCACATTGTGAATTCTACCTGAAGCAGTTCTGGTACTCGTGGCAGGCA
CGTGCATTTTCGCATTTCCTCATTCTGGCAACGCTGGTCGTTGGGAGTGCCTTTATCGTTTTTGTCTACTTGTTC
AATGCGCAGCCAATCACCCGACGCGGCCCATCCAAATTGGCTACTGAGGGCCCGGCTGCGCCTCTTACATCTAGT
GATTTCCGTCGGCAGGCTTGGCTGACTAGCATGCAACGGGTCGGTGTTCCACGTCATAGATTCTTCCGAGAGTGG
TATGTTGTTACTTCGAGATGCTTCGAATACGTCTTACGATGCTTCATGGGATGGAAAGTCTACTCATGGGCCACC
GGAATCACCGAGGAGGATGAGAAGGGACGAGTCAAGACTTGGGATATCGCAATTGATGCTCAACTCACTGGTGGA
GATGCTGAGATCAGCAAGAGCCGCCTTGTGCTCACTATCTTCGCTGCCGGCACACTCCCTTGTACTCCCGCAAGA
ATGATAATAAAGGCCTTGCATGTCCGCATTCTCTTGTGGAACGTCGGAGAGGCGGGCTCCTGGTCATTCCATGTG
TCAAACGACATTGCGCGAGCTCTTGCCAGATTCCAGTGGGGTGTGGCTCGAGAAATCAATTCCGCACTGCCCGAG
GGTCACCCTGATCAGCTTCCCCCTCATCTTGCTGCCCTGATCAAACTGGATTGCGAGGATGTCATGATTGACAAC
ATTATCCAGCGTGCTGTGAACCTGACCTGGAATCGACCAACCCAGGAGGGTACTGGCGATGACGAAGTGCTGCTT
GATGTTGTGGATGAGGACCCAGCTATTCAATGTTCCCAAGATGCACTTGCAGCTTGGTGGTCCAGTCATCTTCTC
CAAACCGCTCTTCTCAACTATTTCGAAGCAAGCGGGAAGGGCCCGGTGTCCAAGGCAAGCCGTGATGCATTCAAA
GAGAAGATTCGGATGTCCCTTGATGTGGCGCCGGTGCTTTCCGCCGCGCATACTCGGGCACTCGTGATGAAAGCC
GTTTTCTTCGAGCACAACCGCATTGAAAATGTTGGGGCGGTTCTTGCCGCGCTACCGAAAGAGAAGAGAAAGGGA
AGTCACAGCCATTCATCCAACTTCCTTGATTCCTCTCTGCCCGTTTCCGTGCGGGATGAAATCTCCATCGCCGTG
CGCTGTGCTATGATTGCCACCATTGTCACCGAACGGTCCACAGGTGGTGTCTCCTCACTACCTGACTCCTTCACC
ATGGAGAAGGCCGTGTCTTGGTTCAATCAGCTTCCGATTGATCCAGTCGAGCTTTCTCTCATCGGTTTCTCGTCT
GTCTATCATCTCCTACACCTCCTCGCCTCTGACGTGGATTACATTGCGTCATCCGATTCATCCCCTTCGGCTCCA
GCCTCGGAGGCGGCTATCTCTTCCGCAGACGACGAAGCCGAAGAAAAACCCCGTCCGAATCAAAAGCTCTCCCTC
TGCCCCCGTGACATTCCCAATCTCGGGCGGGTATCAGCAGAGCTCATATATTGGGCCCGAAATGCCTACACCCCG
GCTTTCTACGGCTTTTCATCTACTCTCGTCGAGGTGATTGTCAACTCGTGCACAGCAATCTGCCAAAATGCAGGC
ATCAATGTTGAAGATTTTGTGCACACCGCACCTGACAGGGCTATGTCTAAGAAACGCAGGACCCGTCGTCGCAAG
GGAGAATCTCAGTCATCCGAAAGCGACGCCGATCAAGACCTGATTGACTATCCTGTCGAAAGACCGCCTCTCCGC
CGGGCACGATCAGCTAGCAACGACACTGGGTATGGCAGCCTCTCTGTTGAAGAAGATGGAAGGCCAATACCTCAT
GCCCCTTCCAATGTACAGGAGGTCCCCAGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail